DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPTN and DIP-eta

DIOPT Version :9

Sequence 1:NP_036560.1 Gene:NPTN / 27020 HGNCID:17867 Length:398 Species:Homo sapiens
Sequence 2:NP_001188701.2 Gene:DIP-eta / 33793 FlyBaseID:FBgn0031725 Length:450 Species:Drosophila melanogaster


Alignment Length:405 Identity:87/405 - (21%)
Similarity:154/405 - (38%) Gaps:80/405 - (19%)


- Green bases have known domain annotations that are detailed below.


Human     9 ALALSLLLVSGSLLPGPGAAQ-NAGFVKSPMSETKLTG-------DAFELYCDVVGSPTPEIQWW 65
            ||::.|||:..|....|...: .|..:..|...:.:..       ||| |.|.|......::.|.
  Fly    14 ALSVILLLILMSQQCYPQRVEVPAEVIVDPKFSSPIVNMTAPVGRDAF-LTCVVQDLGPYKVAWL 77

Human    66 YAEVNRAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQN 130
            ..:   .::...:.:....:...:..|...:....:||..:...|.|.|.|:.:.||.::.:   
  Fly    78 RVD---TQTILTIQNHVITKNQRIGIANSEHKTWTMRIKDIKESDKGWYMCQINTDPMKSQM--- 136

Human   131 PSITWIRAQATISVLQKPRIV---TSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELS 192
                     ..:.|:..|.|:   ||.::::|:..  .|||:|..|.|... |.::..::||.:.
  Fly   137 ---------GYLDVVVPPDILDYPTSTDMVVREGS--NVTLKCAATGSPEP-TITWRRESGVPIE 189

Human   193 -ATRKNASNME---YRINKPRAEDSGEYHCVYHFVSAPKAN--ATIEVKAAPDITGHKRSENKNE 251
             ||.:...::|   ..|...|....|.|.|:......|..:  .|:.|...|.||...:.....|
  Fly   190 LATGEEVMSIEGTDLVIPNVRRHHMGAYLCIASNGVPPSVSKRITLVVHFPPMITVQNQLIGAVE 254

Human   252 GQDATMYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTEL----NIVNLQIT---- 308
            |:..|:.|:|..||.....| .:|.|   :||...|::    ..|.||:    |.:.|.|.    
  Fly   255 GKGVTLDCESEAYPKSINYW-TRERG---EIVPPGGKY----SANVTEIGGYRNSMRLHINPLTQ 311

Human   309 EDPGEYECNATNAIGSA-SVVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDD 372
            .:.|.|.|.|.|::|.. ..:.:.|:..:                .|..:..:|.|.:       
  Fly   312 AEFGSYRCVAKNSLGDTDGTIKLYRIPPN----------------AVNYVENFEARHK------- 353

Human   373 DEPAGPMKTNSTNNH 387
                |..:|.|:.:|
  Fly   354 ----GKKRTKSSESH 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPTNNP_036560.1 Ig 31..146 CDD:416386 19/121 (16%)
Ig strand A 32..36 CDD:409353 0/3 (0%)
Ig strand A' 37..43 CDD:409353 1/5 (20%)
Ig strand B 46..55 CDD:409353 5/8 (63%)
Ig strand C 60..68 CDD:409353 1/7 (14%)
Ig strand C' 73..77 CDD:409353 0/3 (0%)
Ig strand D 87..93 CDD:409353 0/5 (0%)
Ig strand E 96..105 CDD:409353 2/8 (25%)
Ig strand F 112..120 CDD:409353 3/7 (43%)
Ig strand G 136..146 CDD:409353 1/9 (11%)
Narpin, mediates binding with FGFR1 and has antidepressant-like activity. /evidence=ECO:0000250 149..161 4/14 (29%)
Ig 168..219 CDD:416386 14/54 (26%)
Ig strand C 180..185 CDD:409353 1/4 (25%)
Ig strand E 201..205 CDD:409353 1/6 (17%)
Ig strand F 215..219 CDD:409353 1/3 (33%)
Ig_3 238..320 CDD:404760 26/89 (29%)
Ig strand B 255..262 CDD:409353 2/6 (33%)
Ig strand C 268..275 CDD:409353 1/6 (17%)
Ig strand C' 278..280 CDD:409353 0/1 (0%)
Ig strand D 291..295 CDD:409353 0/3 (0%)
Ig strand E 297..302 CDD:409353 2/8 (25%)
Ig strand F 312..320 CDD:409353 4/7 (57%)
Ig strand G 323..333 CDD:409353 1/10 (10%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..398 4/23 (17%)
DIP-etaNP_001188701.2 Ig 51..141 CDD:299845 16/105 (15%)
IG_like 51..137 CDD:214653 16/101 (16%)
IG_like 153..237 CDD:214653 21/86 (24%)
Ig 161..224 CDD:299845 17/65 (26%)
IG_like 252..335 CDD:214653 25/90 (28%)
Ig 258..333 CDD:143165 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.