DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL2 and LSB1

DIOPT Version :10

Sequence 1:NP_009298.1 Gene:ABL2 / 27 HGNCID:77 Length:1182 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:100 Identity:30/100 - (30%)
Similarity:46/100 - (46%) Gaps:12/100 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    94 RWSSKENLLGATESDPNLFV-ALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWV 157
            :|..  |......:|...:| |||||.|..|..||:..|:|::|| ...:.:|...:|.|..|..
Yeast    41 KWDG--NQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVL-EKISPDWYRGKSNNKIGIF 102

Human   158 PSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLIN 192
            |:||:.|.        :....|..:||...||.::
Yeast   103 PANYVKPA--------FTRSASPKSAEAASSSTVS 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL2NP_009298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
CAP 2..106 2/11 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..80
SH3_Abl 111..164 CDD:212784 21/53 (40%)
SH2_ABL 169..262 CDD:198189 5/23 (22%)
PTKc_Abl 281..543 CDD:270645
Kinase activation loop. /evidence=ECO:0000250 427..451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..641
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..674
Nuclear localization signal. /evidence=ECO:0000255 658..660
F-actin-binding. /evidence=ECO:0000250 694..930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 807..851
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1024
F-actin-binding. /evidence=ECO:0000250 1020..1182
FABD 1063..1182 CDD:197885
LSB1NP_011652.1 SH3 55..108 CDD:214620 21/53 (40%)
PRK12323 <100..>156 CDD:481241 10/37 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.