DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL2 and Src64B

DIOPT Version :9

Sequence 1:NP_009298.1 Gene:ABL2 / 27 HGNCID:77 Length:1182 Species:Homo sapiens
Sequence 2:NP_001286937.1 Gene:Src64B / 48973 FlyBaseID:FBgn0262733 Length:553 Species:Drosophila melanogaster


Alignment Length:452 Identity:191/452 - (42%)
Similarity:278/452 - (61%) Gaps:18/452 - (3%)


- Green bases have known domain annotations that are detailed below.


Human   113 VALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVR-SKNGQGWVPSNYITPVNSLEKHSWYHG 176
            |||||:.:..::.||..||:::.|:...::..|..|. :...:|.:|.|::....|:....|:..
  Fly   101 VALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNF
VAEERSVNSEDWFFE 165

Human   177 PVSRSAAEYLLSSLIN--GSFLVRESESSPGQLSISLR--YEGRVY---HYRINTTADGKVYVTA 234
            .|.|..|:.||.:..|  |:||||.||.:|...|:|::  .:||.|   ||||....:|..|:..
  Fly   166 NVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIAT 230

Human   235 ESRFSTLAELVHHHSTV-ADGLVTTLHYPAPKCNKPTVYGVSP-IHDKWEMERTDITMKHKLGGG 297
            ...|.:|..||..:|.. |.||...|..|.|| .:|.::.:.| :.||:|:.|::|.:..|||.|
  Fly   231 NQTFPSLQALVMAYSKENALGLCHILSRP
CPK-PQPQMWDLGPELRDKYEIPRSEIQLLRKLGRG 294

Human   298 QYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTE 362
            .:|||:.|.|:. |:.||||||:|.||....||:|||:||:.:|..||.|..||:.|.|.|||.|
  Fly   295 NFGEVFYGKWRN-SIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQE 358

Human   363 YMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHVVKVAD 427
            ||..|:|||:|||.:...:....|:|:|||::|.|||||.|..|||||||||.|:|||:|.|:.|
  Fly   359 YMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICD 423

Human   428 FGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGIDLS 492
            |||:|::..|.|....|::||:||||||::.|..||||||||::|:||.|:.|||..||||:...
  Fly   424 FGLARVIADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSR 488

Human   493 QVYDLLEKGYRMEQPEG--CPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEV 552
            :|.:.:|:|:||.:|..  .|..:|:|:..||...|..||:|...:..||:.    |::.||
  Fly   489 EVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESF----SVTSEV 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL2NP_009298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
CAP 2..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..80
SH3_Abl 111..164 CDD:212784 15/51 (29%)
SH2_ABL 169..262 CDD:198189 35/100 (35%)
PTKc_Abl 281..543 CDD:270645 130/263 (49%)
Pkinase_Tyr 288..539 CDD:285015 126/252 (50%)
Kinase activation loop. /evidence=ECO:0000250 427..451 10/23 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..641
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..674
Nuclear localization signal. /evidence=ECO:0000255 658..660
F-actin-binding. /evidence=ECO:0000250 694..930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 807..851
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1024
F-actin-binding. /evidence=ECO:0000250 1020..1182
FABD 1063..1182 CDD:197885
Src64BNP_001286937.1 SH3_Src_like 99..150 CDD:212779 14/48 (29%)
SH2_Src_family 158..259 CDD:199827 35/100 (35%)
STYKc 285..537 CDD:214568 126/252 (50%)
PTKc_Src_like 289..538 CDD:270630 125/249 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X88
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.