DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL2 and Crk

DIOPT Version :9

Sequence 1:NP_009298.1 Gene:ABL2 / 27 HGNCID:77 Length:1182 Species:Homo sapiens
Sequence 2:NP_651908.1 Gene:Crk / 43775 FlyBaseID:FBgn0024811 Length:271 Species:Drosophila melanogaster


Alignment Length:222 Identity:54/222 - (24%)
Similarity:87/222 - (39%) Gaps:63/222 - (28%)


- Green bases have known domain annotations that are detailed below.


Human   169 EKHSWYHGPVSR-SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTT--ADGKV 230
            :::|||.||:|| .|.|.|::....|.||||:|.|..|...:.:|.:.:|.:|.||..  .|..|
  Fly     8 DRNSWYFGPMSRQDATEVLMNERERGVFLVRDSNSIAGDYVLCVREDTKVSNYIINKVQQQDQIV 72

Human   231 YVTAESRFSTLAELVHHHSTVADGLVTTLHY------PAPKCNKPTVYGVSPIHDKWEMERTD-- 287
            |...:..|..|.:|:..:         ||||      ..|.|.:     |..:..|::...:|  
  Fly    73 YRIGDQSFDNLPKLLTFY---------TLHYLDTTPLKRPACRR-----VEKVIGKFDFVGSDQD 123

Human   288 ---------ITMKHK---------LGGGQYGEVYVGVWKKY------------------SLTVAV 316
                     :|:..|         ...|:.|::.|...::|                  |..|..
  Fly   124 DLPFQRGEVLTIVRKDEDQWWTARNSSGKIGQIPVPYIQQYDDYMDEDAIDKNEPSISGSSNVFE 188

Human   317 KTLKEDTMEVEEFLKEAAVMKEIKHPN 343
            .|||.  .::...|...|.:|:.:.||
  Fly   189 STLKR--TDLNRKLPAYARVKQSRVPN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL2NP_009298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
CAP 2..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..80
SH3_Abl 111..164 CDD:212784
SH2_ABL 169..262 CDD:198189 33/101 (33%)
PTKc_Abl 281..543 CDD:270645 17/101 (17%)
Pkinase_Tyr 288..539 CDD:285015 16/83 (19%)
Kinase activation loop. /evidence=ECO:0000250 427..451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..641
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..674
Nuclear localization signal. /evidence=ECO:0000255 658..660
F-actin-binding. /evidence=ECO:0000250 694..930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 807..851
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1024
F-actin-binding. /evidence=ECO:0000250 1020..1182
FABD 1063..1182 CDD:197885
CrkNP_651908.1 SH2_CRK_like 4..108 CDD:198180 35/113 (31%)
SH3_CRK_N 109..163 CDD:212692 7/53 (13%)
SH3_CRK_C 201..257 CDD:212693 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.