DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL2 and FER

DIOPT Version :9

Sequence 1:NP_009298.1 Gene:ABL2 / 27 HGNCID:77 Length:1182 Species:Homo sapiens
Sequence 2:NP_524288.3 Gene:FER / 41118 FlyBaseID:FBgn0000723 Length:1325 Species:Drosophila melanogaster


Alignment Length:386 Identity:137/386 - (35%)
Similarity:211/386 - (54%) Gaps:34/386 - (8%)


- Green bases have known domain annotations that are detailed below.


Human   168 LEKHSWYHGPVSRSAAEYLLSSLINGSFLVRES-ESSPGQLSISLRYEGRVYHYRINTTADGKVY 231
            |.:..|:||.:.|.....||::  :|.|||||: .:...|:.:|:.:.|. .|:.:.||.:|...
  Fly   955 LYEEEWFHGVLPREEVVRLLNN--DGDFLVRETIRNEESQIVLSVCWNGH-KHFIVQTTGEGNFR 1016

Human   232 VTAESRFSTLAELVHH--HS----TVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITM 290
            ..... |:::.||:.|  ||    ||..|.:..    .|.|           .::||:...|:.:
  Fly  1017 FEGPP-FASIQELIMHQYHSELPVTVKSGAILR----RPVC-----------RERWELSNDDVVL 1065

Human   291 KHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEE---FLKEAAVMKEIKHPNLVQLLGVCT 352
            ..::|.|.:|:||....|...|.|||||.:. |:..|:   ||:|..::|:..|||:|:|:|:|.
  Fly  1066 LERIGRGNFGDVYKAKLKSTKLDVAVKTCRM-TLPDEQKRKFLQEGRILKQYDHPNIVKLIGICV 1129

Human   353 LEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLV 417
            .:.|..||.|.:..|:||.|||: |...:|....:.|....::.|.|||.||.||||||||||||
  Fly  1130 QKQPIMIVMELVLGGSLLTYLRK-NSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLV 1193

Human   418 GENHVVKVADFGLSRLMTGDTYTAHAGAK-FPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATY 481
            ...|.||::|||:||  ..:.|....|.| .|:||||||:|.:..::...|||::|:|:|||.:.
  Fly  1194 DLEHSVKISDFGMSR--EEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSK 1256

Human   482 GMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETM 542
            |.:||.|:..|:..:.::.||||..|:..|.::|.||..||......||.|.|.:...:.:
  Fly  1257 GDTPYSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDAL 1317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL2NP_009298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
CAP 2..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..80
SH3_Abl 111..164 CDD:212784
SH2_ABL 169..262 CDD:198189 28/99 (28%)
PTKc_Abl 281..543 CDD:270645 106/266 (40%)
Pkinase_Tyr 288..539 CDD:285015 103/254 (41%)
Kinase activation loop. /evidence=ECO:0000250 427..451 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..641
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..674
Nuclear localization signal. /evidence=ECO:0000255 658..660
F-actin-binding. /evidence=ECO:0000250 694..930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 807..851
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1024
F-actin-binding. /evidence=ECO:0000250 1020..1182
FABD 1063..1182 CDD:197885
FERNP_524288.3 F-BAR_Fes_Fer 7..243 CDD:153341
SH2_Fps_family 953..1039 CDD:198224 26/87 (30%)
TyrKc 1063..1311 CDD:197581 103/251 (41%)
PTKc_Fes_like 1067..1315 CDD:270637 103/251 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100013
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.