Sequence 1: | NP_009298.1 | Gene: | ABL2 / 27 | HGNCID: | 77 | Length: | 1182 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001246118.1 | Gene: | Dap160 / 35378 | FlyBaseID: | FBgn0023388 | Length: | 1190 | Species: | Drosophila melanogaster |
Alignment Length: | 193 | Identity: | 49/193 - (25%) |
---|---|---|---|
Similarity: | 77/193 - (39%) | Gaps: | 28/193 - (14%) |
- Green bases have known domain annotations that are detailed below.
Human 37 PAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSP-EALHRPYGCDVEPQA--LNEAIRWSS- 97
Human 98 ---KENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPS 159
Human 160 NYI-------------TPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRE-SE---SSPG 205 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |