DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL2 and Socs16D

DIOPT Version :9

Sequence 1:NP_009298.1 Gene:ABL2 / 27 HGNCID:77 Length:1182 Species:Homo sapiens
Sequence 2:NP_001259662.1 Gene:Socs16D / 32760 FlyBaseID:FBgn0030869 Length:1021 Species:Drosophila melanogaster


Alignment Length:230 Identity:52/230 - (22%)
Similarity:87/230 - (37%) Gaps:70/230 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   161 YITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRI--- 222
            :.:.:..::.:.||.||:|..|||.:|||..:|||:||:|.......|:|.:....|.|.||   
  Fly   838 FTSSIEKVKDYGWYWGPLSSEAAEKVLSSEPDGSFIVRDSSDDHYIFSLSFKLNNCVRHVRIEQD 902

Human   223 -NTTADGKVYVTAESRFSTLAELVH---HHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEM 283
             .|.:.|..   |:.:..|:.|.:.   .||. :...:..||.             .|.|....:
  Fly   903 QGTFSFGSY---AKFKSQTITEFIEKAVEHSR-SGRYLFFLHR-------------RPEHGPMRV 950

Human   284 ERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLL 348
            :.|:...:.|                     .|::|        :.:....::|.:...:|:|  
  Fly   951 QLTNPVSRFK---------------------HVQSL--------QHMCRFVILKAVIRKDLIQ-- 984

Human   349 GVCTLEPPFYIVTEYMPYGNLLDYL--RECNREEV 381
               ||..|          ..|||||  :.|..|:|
  Fly   985 ---TLPLP----------RRLLDYLNYKHCYSEQV 1006

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL2NP_009298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
CAP 2..106
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..80
SH3_Abl 111..164 CDD:212784 0/2 (0%)
SH2_ABL 169..262 CDD:198189 32/99 (32%)
PTKc_Abl 281..543 CDD:270645 18/103 (17%)
Pkinase_Tyr 288..539 CDD:285015 17/96 (18%)
Kinase activation loop. /evidence=ECO:0000250 427..451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..641
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..674
Nuclear localization signal. /evidence=ECO:0000255 658..660
F-actin-binding. /evidence=ECO:0000250 694..930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 807..851
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1024
F-actin-binding. /evidence=ECO:0000250 1020..1182
FABD 1063..1182 CDD:197885
Socs16DNP_001259662.1 SH2_SOCS7 839..937 CDD:198251 30/101 (30%)
SOCS_SOCS7 960..1009 CDD:239710 17/91 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.