DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ABL2 and skb5

DIOPT Version :10

Sequence 1:NP_009298.1 Gene:ABL2 / 27 HGNCID:77 Length:1182 Species:Homo sapiens
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:130 Identity:32/130 - (24%)
Similarity:51/130 - (39%) Gaps:16/130 - (12%)


- Green bases have known domain annotations that are detailed below.


Human    37 PAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGGSSPEALHRPYGCDVE---PQALNEAIRWSSK 98
            |.......||:.....:.....|:|.|:....|....|::.     |.|   ....:|:...|:.
pombe    19 PPDHELHYGFHARVIEEEEERFVDDTFDETIEGSDDSESID-----DTEVFYDAEESESTHPSAS 78

Human    99 ENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQ-GWVPSNYI 162
            .|:|...       ||||||....||.|..|.|::|.:|..:.:|........:|: |.||..::
pombe    79 FNVLADA-------VALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSGLVPETFV 136

Human   163  162
            pombe   137  136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ABL2NP_009298.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47 2/9 (22%)
CAP 2..106 14/71 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..80 4/19 (21%)
SH3_Abl 111..164 CDD:212784 18/53 (34%)
SH2_ABL 169..262 CDD:198189
PTKc_Abl 281..543 CDD:270645
Kinase activation loop. /evidence=ECO:0000250 427..451
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 611..641
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 654..674
Nuclear localization signal. /evidence=ECO:0000255 658..660
F-actin-binding. /evidence=ECO:0000250 694..930
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 763..794
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 807..851
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 964..1024
F-actin-binding. /evidence=ECO:0000250 1020..1182
FABD 1063..1182 CDD:197885
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 18/60 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.