DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Eif4e2 and eIF4EHP

DIOPT Version :9

Sequence 1:XP_036021474.1 Gene:Eif4e2 / 26987 MGIID:1914440 Length:265 Species:Mus musculus
Sequence 2:NP_001163710.1 Gene:eIF4EHP / 326255 FlyBaseID:FBgn0053100 Length:248 Species:Drosophila melanogaster


Alignment Length:133 Identity:62/133 - (46%)
Similarity:89/133 - (66%) Gaps:2/133 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse    50 GPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFH 114
            ||.|:.||:.|..|:||:...|  ::..|.:::..:|..|||:|:|..|||::||..|..:.:..
  Fly    42 GPGENRLQHTYCLWFSRKETQR--AAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPYRELL 104

Mouse   115 LFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDI 179
            |||:||.|||||.||..||:|:|||||....|.|||:.:|||||||:||:||||.|:..::....
  Fly   105 LFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQFLVGDEICGVVLQTKYPNPS 169

Mouse   180 ISI 182
            |.:
  Fly   170 IQV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Eif4e2XP_036021474.1 IF4E 55..214 CDD:396291 59/128 (46%)
eIF4EHPNP_001163710.1 IF4E 50..>172 CDD:279921 57/123 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830798
Domainoid 1 1.000 136 1.000 Domainoid score I4942
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4466
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004798
OrthoInspector 1 1.000 - - oto93180
orthoMCL 1 0.900 - - OOG6_101698
Panther 1 1.100 - - LDO PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2584
SonicParanoid 1 1.000 - - X3380
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.780

Return to query results.
Submit another query.