DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Islr and CG7896

DIOPT Version :9

Sequence 1:XP_006511267.1 Gene:Islr / 26968 MGIID:1349645 Length:436 Species:Mus musculus
Sequence 2:NP_651754.1 Gene:CG7896 / 43552 FlyBaseID:FBgn0039728 Length:1392 Species:Drosophila melanogaster


Alignment Length:403 Identity:92/403 - (22%)
Similarity:151/403 - (37%) Gaps:99/403 - (24%)


- Green bases have known domain annotations that are detailed below.


Mouse    41 IADCAYRDLEGVPPGFPANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRSVAIGALAPL 105
            |...|::.|:        .:..:.|:.||:..|....|.::..||.|.|:.|........|||.:
  Fly   247 IDSLAFKGLQ--------KIREIKLAGNRISHLNSDVFEKLQSLQKLDLSENFFGQFPTVALAAV 303

Mouse   106 SHLKSLDLSHNLLSEFAWSDLHNLSALQLLKMDSNELAFIPRDAFSSLSALRSLQLNHNRLHALA 170
            ..||.|:||.|:|.:..::.:..:.:|:.|.:..|.:..|....|..:.||:.|.|:.|.|..:.
  Fly   304 PGLKHLNLSSNMLQQLDYTHMQVVRSLESLDISRNTITTITPGTFREMGALKYLDLSLNSLRTIE 368

Mouse   171 EGTFAPLTALSHLQINDNPFDCTCGIVWFKTWALASAVSIPEQDNIACTTPHVLKGIPLGRLPPL 235
            :.....|.:|..|.|.||                          ||.     ::.|..|||||.|
  Fly   369 DDALEGLDSLQTLIIKDN--------------------------NIL-----LVPGSALGRLPQL 402

Mouse   236 PCSAPSVQLSYQ-----PSQDGAELRPGFV--LALHCDVDGQPVP---QLHWHIHT---PGGTVE 287
                .|:||.|.     .::....|:.|.:  |:|..:|..:..|   |:...:||   .|.::.
  Fly   403 ----TSLQLDYNRVAALSAEILGSLQAGDITTLSLSRNVIRELPPGSFQMFSSLHTLDLSGNSLA 463

Mouse   288 IASPNVGTDGRALPGALATSGQPRFQAFANGSLLIPDFGKLEEGTYSCLATNELGSAESSVNVAL 352
            :.:.:......:...||..| |.|.........::|:...|:      |:.|.|....|::...|
  Fly   464 VINADTFAGLESTLMALKLS-QNRLTGLGGAPWVLPELRSLD------LSGNTLTELPSTIFEEL 521

Mouse   353 ATPGEGGEDAVGHKFHGKAVEGKGCYTVDNEVQP-SG----PEDNVVIIYLSRAGPPEAAIAADG 412
                   |:.......|            |.:.| :|    |.|.:.:|.||            |
  Fly   522 -------ENVQSLNLSG------------NHLTPLTGALFKPLDRLQVIDLS------------G 555

Mouse   413 RPAQQFSGILLLG 425
            ...:|.||.||.|
  Fly   556 CNIRQISGDLLAG 568

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IslrXP_006511267.1 leucine-rich repeat 40..59 CDD:275380 3/17 (18%)
LRR_8 59..118 CDD:338972 19/58 (33%)
leucine-rich repeat 60..83 CDD:275380 5/22 (23%)
leucine-rich repeat 84..107 CDD:275380 8/22 (36%)
LRR_8 107..166 CDD:338972 17/58 (29%)
leucine-rich repeat 108..131 CDD:275380 7/22 (32%)
leucine-rich repeat 132..155 CDD:275380 5/22 (23%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
PCC 161..>235 CDD:188093 17/73 (23%)
Ig 263..349 CDD:319273 18/91 (20%)
CG7896NP_651754.1 LRR_8 109..172 CDD:290566
leucine-rich repeat 109..132 CDD:275380
LRR_RI <132..338 CDD:238064 25/98 (26%)
leucine-rich repeat 133..161 CDD:275380
LRR_8 160..220 CDD:290566
leucine-rich repeat 162..185 CDD:275380
leucine-rich repeat 186..209 CDD:275380
leucine-rich repeat 210..233 CDD:275380
LRR_8 232..290 CDD:290566 12/50 (24%)
leucine-rich repeat 234..257 CDD:275380 3/17 (18%)
leucine-rich repeat 258..281 CDD:275380 5/22 (23%)
LRR_RI 273..535 CDD:238064 71/322 (22%)
LRR_8 281..338 CDD:290566 17/56 (30%)
leucine-rich repeat 282..329 CDD:275380 15/46 (33%)
LRR_8 328..388 CDD:290566 17/85 (20%)
leucine-rich repeat 330..353 CDD:275380 5/22 (23%)
leucine-rich repeat 354..377 CDD:275380 6/22 (27%)
leucine-rich repeat 378..401 CDD:275380 12/53 (23%)
leucine-rich repeat 402..425 CDD:275380 6/26 (23%)
leucine-rich repeat 428..451 CDD:275380 5/22 (23%)
LRR_8 429..487 CDD:290566 12/58 (21%)
leucine-rich repeat 452..473 CDD:275380 3/20 (15%)
leucine-rich repeat 477..497 CDD:275378 5/20 (25%)
LRR_8 498..558 CDD:290566 18/96 (19%)
leucine-rich repeat 500..523 CDD:275380 6/35 (17%)
LRR_RI 502..769 CDD:238064 23/104 (22%)
leucine-rich repeat 524..547 CDD:275380 5/34 (15%)
leucine-rich repeat 548..571 CDD:275380 10/33 (30%)
LRR_8 572..630 CDD:290566
leucine-rich repeat 572..595 CDD:275380
leucine-rich repeat 596..619 CDD:275380
LRR_8 619..678 CDD:290566
leucine-rich repeat 620..643 CDD:275380
leucine-rich repeat 644..667 CDD:275380
LRR_8 666..726 CDD:290566
leucine-rich repeat 668..691 CDD:275380
leucine-rich repeat 692..715 CDD:275380
LRR_8 714..774 CDD:290566
leucine-rich repeat 716..739 CDD:275380
leucine-rich repeat 740..761 CDD:275380
leucine-rich repeat 764..789 CDD:275380
leucine-rich repeat 790..810 CDD:275380
leucine-rich repeat 818..850 CDD:275380
leucine-rich repeat 863..883 CDD:275378
LRR_RI <878..1070 CDD:238064
LRR_8 884..944 CDD:290566
LRR_4 884..925 CDD:289563
leucine-rich repeat 884..907 CDD:275380
leucine-rich repeat 908..933 CDD:275380
leucine-rich repeat 934..955 CDD:275380
leucine-rich repeat 958..982 CDD:275380
leucine-rich repeat 983..1055 CDD:275380
leucine-rich repeat 1009..1033 CDD:275380
leucine-rich repeat 1058..1085 CDD:275380
TPKR_C2 1121..1168 CDD:301599
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24366
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.