DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Macroh2a1 and His2A:CG33829

DIOPT Version :10

Sequence 1:NP_036145.1 Gene:Macroh2a1 / 26914 MGIID:1349392 Length:372 Species:Mus musculus
Sequence 2:NP_001027326.1 Gene:His2A:CG33829 / 3772447 FlyBaseID:FBgn0053829 Length:124 Species:Drosophila melanogaster


Alignment Length:123 Identity:79/123 - (64%)
Similarity:93/123 - (75%) Gaps:2/123 - (1%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MSSR--GGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEILEL 63
            ||.|  |||.|....|||.:||:.|||||:.|.::||:...|:|.|||||:|||:|||.||:|||
  Fly     1 MSGRGKGGKVKGKAKSRSNRAGLQFPVGRIHRLLRKGNYAERVGAGAPVYLAAVMEYLAAEVLEL 65

Mouse    64 AGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGSK 121
            ||||||||||.|:.|||:.||:.||||||:||.|||||.|||||||...||.||...|
  Fly    66 AGNAARDNKKTRIIPRHLQLAIRNDEELNKLLSGVTIAQGGVLPNIQAVLLPKKTEKK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Macroh2a1NP_036145.1 H2A 14..119 CDD:197711 71/104 (68%)
Macro_H2A-like 178..368 CDD:394875
His2A:CG33829NP_001027326.1 PTZ00017 16..124 CDD:185399 72/108 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.