DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Figla and Fer1

DIOPT Version :9

Sequence 1:NP_036143.1 Gene:Figla / 26910 MGIID:1349421 Length:194 Species:Mus musculus
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:148 Identity:40/148 - (27%)
Similarity:66/148 - (44%) Gaps:38/148 - (25%)


- Green bases have known domain annotations that are detailed below.


Mouse    59 ERRRVANAKERERIKNLNRGFAKLKALVPFLPQSRKPSKVDILKGATEYIQILGCVLEEAKVS-- 121
            ::|:.||.:||.|::::|..|..|:..:|.||..::.||||.||.|..||..|..::::.|..  
  Fly    86 QQRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLSKVDTLKLAISYITFLSEMVKKDKNGNE 150

Mouse   122 ---------EKQSPEE---------QTHS---GRPSDPHVSSTRELLGNATQPTSCASGLKKEEE 165
                     :|:.|::         ..||   .|..|.:..|  :|......|        ::..
  Fly   151 PGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDRYPGS--KLYARTWTP--------EDPR 205

Mouse   166 GPWAYAGHSEPLYSYHQS 183
            ||     ||:||..|:.|
  Fly   206 GP-----HSQPLPLYNNS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FiglaNP_036143.1 HLH 59..116 CDD:238036 22/56 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..163 9/64 (14%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.