DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ctsj and CG5367

DIOPT Version :9

Sequence 1:NP_001343220.1 Gene:Ctsj / 26898 MGIID:1349426 Length:334 Species:Mus musculus
Sequence 2:NP_609387.1 Gene:CG5367 / 34401 FlyBaseID:FBgn0032228 Length:338 Species:Drosophila melanogaster


Alignment Length:316 Identity:112/316 - (35%)
Similarity:182/316 - (57%) Gaps:26/316 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    27 AEWKDWKT----KYAKSYSPKEEALRRAVWEENMRMIKLHNKENSLGKNNFTMKMNKFGDQTSEE 87
            :|::.:|.    ||.::|   :|......:|||.::|:.||:....|:.:|.:|.|.|.|.:::.
  Fly    34 SEFEKFKNNNNRKYLRTY---DEMRSYKAFEENFKVIEEHNQNYKEGQTSFRLKPNIFADMSTDG 95

Mouse    88 FRKSIDNIPIPAAMTDPHAQNHVSI-------GLPDYKDWREEGYVTPVRNQGKCGSCWAFAAAG 145
            :.|..  :.:..:..:..|.|...|       .:|:..|||.:|::||..||..||||:||:.|.
  Fly    96 YLKGF--LRLLKSNIEDSADNMAEIVGSPLMANVPESLDWRSKGFITPPYNQLSCGSCYAFSIAE 158

Mouse   146 AIEGQMFWKTGNLTPLSVQNLLDCSKTVGNKGCQSGTAHQAFEYVLKNKGLEAEATYPYEGKDGP 210
            :|.||:|.:||.:..||.|.::|||.:.||:||..|:......|:....|:..:..|||..:.|.
  Fly   159 SIMGQVFKRTGKILSLSKQQIVDCSVSHGNQGCVGGSLRNTLSYLQSTGGIMRDQDYPYVARKGK 223

Mouse   211 CRYRSENASANITDYVNLP-PNELYLWVAVASIGPVSAAIDASHDSFRFYNGGIYYEPNCSSYFV 274
            |::..:.:..|:|.:..|| .:|..:..||..||||:.:|:||..:|:.|:.|||.:|.|||..|
  Fly   224 CQFVPDLSVVNVTSWAILPVRDEQAIQAAVTHIGPVAISINASPKTFQLYSDGIYDDPLCSSASV 288

Mouse   275 NHAVLVVGYGSEGDVKDGNNYWLIKNSWGEEWGMNGYMQIAKDHNNHCGIASLASY 330
            |||::|:|:|.:        ||::||.||:.||.|||::|.|. .|.||||:.|:|
  Fly   289 NHAMVVIGFGKD--------YWILKNWWGQNWGENGYIRIRKG-VNMCGIANYAAY 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CtsjNP_001343220.1 Inhibitor_I29 29..87 CDD:214853 17/61 (28%)
Peptidase_C1 114..331 CDD:306594 90/218 (41%)
CG5367NP_609387.1 Inhibitor_I29 36..96 CDD:285458 17/62 (27%)
Peptidase_C1A 128..336 CDD:239068 90/217 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4870
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53545
OrthoDB 1 1.010 - - D1275401at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.