DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lsamp and DIP-delta

DIOPT Version :9

Sequence 1:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:322 Identity:97/322 - (30%)
Similarity:142/322 - (44%) Gaps:47/322 - (14%)


- Green bases have known domain annotations that are detailed below.


Mouse    65 FNRGTDNITVRQGDTAILRCVVEDKNS-KVAW--LNRSGIIFAGHDKWSLDPRVELEKRHALEYS 126
            |.:...|:||..|..|.|.||||.... ||||  ::|..|:.......|..|      |:::.|:
  Fly    46 FAQPIPNVTVAVGRDANLPCVVEHLGGYKVAWIHIDRQMILTIHRHVISRIP------RYSITYT 104

Mouse   127 -----LRIQKVDVYDEGSYTCSVQTQHEPKTSQV-YLIVQVPPKISNIS---SDVTVNEGSNVTL 182
                 |.:.:....|.|.|.|.|.|  .|..||| ||.|.|||.|.:|.   |.|.|.|..|:.:
  Fly   105 DNTWLLHVNQAHQDDRGYYMCQVNT--NPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINM 167

Mouse   183 VCMANGRPEPVITWRHLTPLGREFEGEE--------------EYLEILGITREQSGKYECKAANE 233
            .|.|:|.|.|.|.||      || :|||              :.|.:..::|.:.|.|.|.|.|.
  Fly   168 TCRADGFPAPKIIWR------RE-DGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNG 225

Mouse   234 VSSADVKQVKVTVNYPPTI-TESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEI 297
            |..:..|::.:.|.:.|.| ..::...|.:|...::.|...|.|.....|..:...:..:...:.
  Fly   226 VPPSVSKRIILDVEFSPMIWVPNQLVGAPSGTDVTIDCHTEAHPKAIIYWVYNSVMVLPSKKYKT 290

Mouse   298 KSTE----GQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTVPHPIQEIGTTV 355
            ..||    ....||:.|:....:|||.|::.|.||.|..|:.:::..||:.|.. |...|||
  Fly   291 DYTENSYRAHMKLTIRNLQYGDFGNYRCISKNSLGETEGSIRVYEIPLPSTPSK-QVTHTTV 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LsampXP_030104997.1 Ig 69..159 CDD:386229 33/98 (34%)
Ig_3 163..232 CDD:372822 27/85 (32%)
Ig_3 250..325 CDD:372822 17/79 (22%)
DIP-deltaNP_001097508.2 IG 51..143 CDD:214652 34/99 (34%)
Ig 145..238 CDD:416386 30/99 (30%)
Ig strand A 145..149 CDD:409353 2/3 (67%)
Ig strand A' 154..159 CDD:409353 2/4 (50%)
Ig strand B 165..172 CDD:409353 1/6 (17%)
Ig strand C 178..183 CDD:409353 3/10 (30%)
Ig strand C' 185..187 CDD:409353 0/1 (0%)
Ig strand D 195..199 CDD:409353 0/3 (0%)
Ig strand E 203..209 CDD:409353 1/5 (20%)
Ig strand F 216..223 CDD:409353 3/6 (50%)
Ig strand G 230..238 CDD:409353 1/7 (14%)
Ig 242..333 CDD:416386 22/90 (24%)
Ig strand A' 250..253 CDD:409353 0/2 (0%)
Ig strand B 259..266 CDD:409353 1/6 (17%)
Ig strand C 272..277 CDD:409353 1/4 (25%)
Ig strand C' 281..283 CDD:409353 0/1 (0%)
Ig strand D 289..293 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 314..322 CDD:409353 4/7 (57%)
Ig strand G 325..334 CDD:409353 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12107
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 142 1.000 Inparanoid score I4449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D265311at33208
OrthoFinder 1 1.000 - - FOG0000150
OrthoInspector 1 1.000 - - mtm8732
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X97
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.