DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment B3galt1 and brn

DIOPT Version :9

Sequence 1:NP_001366253.1 Gene:B3galt1 / 26877 MGIID:1349403 Length:326 Species:Mus musculus
Sequence 2:NP_476901.1 Gene:brn / 31358 FlyBaseID:FBgn0000221 Length:325 Species:Drosophila melanogaster


Alignment Length:350 Identity:104/350 - (29%)
Similarity:161/350 - (46%) Gaps:53/350 - (15%)


- Green bases have known domain annotations that are detailed below.


Mouse     1 MASK-----VSCLYVLTVVCWA------SALWYLSITR----PTSSYTGS-------KPFSHLTV 43
            |.||     :.||.||.::...      :.|..|:..|    |.:..|||       ..|::|.|
  Fly     1 MQSKHRKLLLRCLLVLPLILLVDYCGLLTHLHELNFERHFHYPLNDDTGSGSASSGLDKFAYLRV 65

Mouse    44 ARKNFTFGNIRTRPINPHSFEFLINEPNKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFK 108
              .:||             .|..:::|.:       |.:||.:.......|:|||.|||.|..|.
  Fly    66 --PSFT-------------AEVPVDQPAR-------LTMLIKSAVGNSRRREAIRRTWGYEGRFS 108

Mouse   109 GIKIATLFLLGKNADPVLNQMVEQESQIFHDIIVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYV 173
            .:.:..:||||...|.  .:.|..||:...||:..:|.|:|.|.||||::||||.:...:::::.
  Fly   109 DVHLRRVFLLGTAEDS--EKDVAWESREHGDILQAEFTDAYFNNTLKTMLGMRWASDQFNRSEFY 171

Mouse   174 MKTDSDIFVNMDNLIYKLL---KPSTKPRRRYFTGYVINGGPIRDVRSKWYMPRDLYPDSNYPPF 235
            :..|.|.:|:..|:: |.|   :.|.:| ...|.|:|....|:|...||||:..:.||...:||:
  Fly   172 LFVDDDYYVSAKNVL-KFLGRGRQSHQP-ELLFAGHVFQTSPLRHKFSKWYVSLEEYPFDRWPPY 234

Mouse   236 CSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAY-SLCRYRR 299
            .:...:|.|......:|..|:|..|...:|||:|:...|.||.......|...:.|| ....|..
  Fly   235 VTAGAFILSQKALRQLYAASVHLPLFRFDDVYLGIVALKAGISLQHCDDFRFHRPAYKGPDSYSS 299

Mouse   300 VITVHQI-SPEEMHRIWNDMSSKKH 323
            ||..|:. .||||.|:||:..|..:
  Fly   300 VIASHEFGDPEEMTRVWNECRSANY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
B3galt1NP_001366253.1 Galactosyl_T 92..279 CDD:250845 65/189 (34%)
brnNP_476901.1 Galactosyl_T 92..282 CDD:250845 65/193 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167847389
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6002
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1037602at2759
OrthoFinder 1 1.000 - - FOG0000088
OrthoInspector 1 1.000 - - otm42774
orthoMCL 1 0.900 - - OOG6_100261
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X41
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.800

Return to query results.
Submit another query.