DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ADGRF1 and mthl4

DIOPT Version :9

Sequence 1:NP_722582.2 Gene:ADGRF1 / 266977 HGNCID:18990 Length:910 Species:Homo sapiens
Sequence 2:NP_788394.1 Gene:mthl4 / 36960 FlyBaseID:FBgn0034219 Length:517 Species:Drosophila melanogaster


Alignment Length:543 Identity:113/543 - (20%)
Similarity:200/543 - (36%) Gaps:141/543 - (25%)


- Green bases have known domain annotations that are detailed below.


Human   410 NISTLVPPTALPLNFSRKFIDWKGIPVNKSQLK-----RGYSYQIK-----MCPQ---------- 454
            |.|.|.....:|.:.:.:: |:| :..:.|:.|     ||.:..::     .|||          
  Fly    39 NGSYLYEGLLIPAHLTAEY-DYK-LLADDSKEKVASHVRGCACHLRPCIRFCCPQYQKMQKSKCY 101

Human   455 --------NTSIPIRGRVLIGSDQFQRSLPETIISMASLT---------LGNILPVSKNGNAQVN 502
                    |...|.....|......:|...|.:|..:.|.         |.:.||    ||.   
  Fly   102 GDMSEDELNKHDPFVNVTLSDGSVVRRHFKEDLIVQSDLAKPGCPRMYFLNHELP----GNE--- 159

Human   503 GPVISTVIQNYSINEVFLFFSKIESNLSQPHCVFWDFSHLQWNDAGCHLVNETQDIVTCQCTHLT 567
                .|:.:|.|:   ...:.|:|.: .:.:||    .||.:.|.                    
  Fly   160 ----FTLFENGSL---LRHWDKVELS-KREYCV----QHLSFKDD-------------------- 192

Human   568 SFSILMSP-FVPSTIFPVVKWITYVGLGISIGSLILCLIIEALFWKQIKKSQTSHTRRICMVNIA 631
              ||.::| |.|.:......|.| |.:.||    ::|:|:....:..::|.:..|.:  |.:...
  Fly   193 --SIRIAPHFCPLSSEHSRTWKT-VAIVIS----LICIILTISVYLYVEKLRNLHGK--CFICYL 248

Human   632 LSL------LIADVWFIVGATVDTTVNPSGVCTAAVFFTHFFYLSLFFWMLMLGILLAYRIILV- 689
            .||      |:.:||          ...||.|..|.|..:|..::.|||:.::||.|..:..|. 
  Fly   249 ASLFLGYFFLVLNVW----------KYSSGFCVTAGFLGYFSVMAAFFWLSVIGIHLRIKFSLAS 303

Human   690 --FHHMAQHLMMAVGFCLGYGCPLIISVITIAVTQPSNTYK---RKDV---CWLNWSNGSKPLLA 746
              .|.:.............:|.|||::.||....|.....|   |..|   ||: ::.....::.
  Fly   304 NCLHRLLPENPFRAYNLYAWGIPLIMTAITYTADQVVKNEKLRPRVGVGKNCWI-YTGDMTVMIY 367

Human   747 FVVPALAIVAVNFVVVLLVLTKLWRPTVGERLS------------RDDKATIIRVGKSLLILTPL 799
            |..|.|.::|.|  :::.||:.::...:.:.:.            .|.:...|     .|.|..|
  Fly   368 FYGPMLLLIAFN--IIMFVLSAIYIYNIKKNVKGLVHKQQTNQQINDQQMFAI-----FLRLFIL 425

Human   800 LGLTWGFGIGTIVDSQNLAWH---VIFALLNAFQGFFILCFGILLDSKLRQLLFNKLSAL----- 856
            :||:|.|.|.:.:.::..||.   ::....|..||..|....||..|.|:.::......|     
  Fly   426 MGLSWSFEILSFLLTKQQAWARALMVADYFNWSQGTIIFVLFILKPSILKLIIAGGRQNLPGSHH 490

Human   857 SSWKQTEKQNSSDLSAKPKFSKP 879
            :|..:..:.||:..:.:...:.|
  Fly   491 NSRSKAARYNSTHTACEGSIADP 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ADGRF1NP_722582.2 SEA 154..>215 CDD:279699
GPS 532..572 CDD:280071 6/39 (15%)
7tm_4 582..834 CDD:304433 63/281 (22%)
mthl4NP_788394.1 Methuselah_N 23..201 CDD:284145 38/204 (19%)
7tm_4 213..>385 CDD:304433 45/191 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8337
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.