DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MDGA1 and DIP-delta

DIOPT Version :10

Sequence 1:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens
Sequence 2:NP_001097508.2 Gene:DIP-delta / 5740816 FlyBaseID:FBgn0085420 Length:469 Species:Drosophila melanogaster


Alignment Length:313 Identity:78/313 - (24%)
Similarity:127/313 - (40%) Gaps:44/313 - (14%)


- Green bases have known domain annotations that are detailed below.


Human     8 LLALIPFHCRGQGVY---APAQAQIVHAGQACVVKEDNISERVYT-----IREGDTLMLQCLVTG 64
            ||.:...|...:|.|   ......|...|...||...||.:...|     :||...:.:.|...|
  Fly   109 LLHVNQAHQDDRGYYMCQVNTNPMISQVGYLQVVVPPNILDIESTPSSVAVRENQNINMTCRADG 173

Human    65 HPRPQVRWTKTAGS--ASDKFQETSVFN-ETLRIERIARTQGGRYYCKAENGVGVPAIKSIRVDV 126
            .|.|::.|.:..|.  |.:|.::..|:: :.|.:.:::|.:.|.|.|.|.|||.....|.|.:||
  Fly   174 FPAPKIIWRREDGEEIAVEKKKKVLVYDADVLPLTKVSRNEMGAYLCIATNGVPPSVSKRIILDV 238

Human   127 QYLDEPMLTV-HQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQDNGVDIYEPL 190
            ::  .||:.| :|.|....|.     .|.:.|...::|.|...|...|..:..|:.     |:..
  Fly   239 EF--SPMIWVPNQLVGAPSGT-----DVTIDCHTEAHPKAIIYWVYNSVMVLPSKK-----YKTD 291

Human   191 YTQGETKV---LKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPPALKLSVNETLVV 252
            ||:...:.   |.::||:..|:.:|.| :| :|..|..:.:|  |:.....|......|..|.|.
  Fly   292 YTENSYRAHMKLTIRNLQYGDFGNYRC-IS-KNSLGETEGSI--RVYEIPLPSTPSKQVTHTTVE 352

Human   253 NPGENVTVQCLLTGGDPLPQLQWSHG--------PGPLPLGALAQGGTLSIPS 297
            :...|:...   :..|....||...|        ||  ...:.:.||:.|..|
  Fly   353 SRENNIIPS---SRNDTTKSLQTDVGYAMKNDLYPG--SASSSSSGGSSSAAS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MDGA1XP_006715119.1 Ig 44..115 CDD:472250 20/78 (26%)
Ig strand B 56..60 CDD:409353 0/3 (0%)
Ig strand C 69..73 CDD:409353 0/3 (0%)
Ig strand E 91..95 CDD:409353 1/3 (33%)
Ig strand F 105..110 CDD:409353 2/4 (50%)
IG_like 152..217 CDD:214653 16/67 (24%)
Ig strand B 153..157 CDD:409353 1/3 (33%)
Ig strand C 166..170 CDD:409353 0/3 (0%)
Ig strand E 197..201 CDD:409353 1/6 (17%)
Ig strand F 211..216 CDD:409353 2/4 (50%)
IG_like 248..326 CDD:214653 13/58 (22%)
Ig strand B 258..262 CDD:409412 0/3 (0%)
Ig strand C 272..276 CDD:409412 2/3 (67%)
Ig strand E 291..295 CDD:409412 1/3 (33%)
Ig strand F 305..310 CDD:409412
Ig 334..418 CDD:472250
Ig strand B 353..357 CDD:409353
Ig strand C 368..372 CDD:409353
Ig strand E 398..402 CDD:409353
Ig strand F 412..417 CDD:409353
Ig_3 439..515 CDD:464046
Ig_3 538..619 CDD:464046
MAM 753..916 CDD:99706
DIP-deltaNP_001097508.2 IG_like 51..143 CDD:214653 8/33 (24%)
Ig strand B 61..65 CDD:409353
Ig strand C 74..78 CDD:409353
Ig strand E 105..112 CDD:409353 2/2 (100%)
Ig strand F 122..127 CDD:409353 1/4 (25%)
Ig strand G 134..137 CDD:409353 0/2 (0%)
Ig 145..238 CDD:472250 25/92 (27%)
Ig strand B 165..169 CDD:409353 0/3 (0%)
Ig strand C 178..182 CDD:409353 0/3 (0%)
Ig strand E 203..207 CDD:409353 1/3 (33%)
Ig strand F 217..222 CDD:409353 2/4 (50%)
Ig strand G 231..234 CDD:409353 1/2 (50%)
Ig 242..333 CDD:472250 26/104 (25%)
Ig strand B 259..263 CDD:409353 1/3 (33%)
Ig strand C 272..276 CDD:409353 0/3 (0%)
Ig strand E 295..305 CDD:409353 1/9 (11%)
Ig strand F 315..320 CDD:409353 2/5 (40%)
Ig strand G 328..331 CDD:409353 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.