DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MDGA1 and Sr-CIII

DIOPT Version :9

Sequence 1:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens
Sequence 2:NP_524747.1 Gene:Sr-CIII / 44382 FlyBaseID:FBgn0020376 Length:320 Species:Drosophila melanogaster


Alignment Length:194 Identity:46/194 - (23%)
Similarity:78/194 - (40%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


Human   747 NLSDNTCHFEDEKICGYTQDLTDNFDWTRQNA----LTQNPKRSPNTGPPTDISGTPEGYYMFIE 807
            ::.|::|.||.|.:||:.........|.|.:|    |.:...:..:|     .....||:::.::
  Fly   137 SVGDHSCDFEREDMCGWRASKAIPQPWKRISAAADFLKEKCLQQDHT-----FQSDVEGHFIRLQ 196

Human   808 T----SRPRELGDRARLVSPLY------NASAKFYCVSFFYHMYGKHIGSLNLLVRSRNKGALDT 862
            :    ||      ....:||:|      ..|..|   .|...|:|..:.:|.:.|:..:....| 
  Fly   197 SQVHASR------TYHFISPIYPRNLTVGHSLWF---QFELFMFGSEVRNLTISVKPSSMAVED- 251

Human   863 HAW----------SLSGNKGNVWQQAHVPISP-SGPFQIIFEGVRGPGYLGDIAIDDVTLKKGE 915
             .|          ::||::|..|:...:.|.. ...||::|..|......|||.||||...|.|
  Fly   252 -MWNSFRNICTKLTVSGDQGPNWKSQSISIDEMESDFQVVFTVVDPSSLHGDIGIDDVKFIKSE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MDGA1XP_006715119.1 IG_like 46..126 CDD:214653
IGc2 52..115 CDD:197706
IG_like 152..217 CDD:214653
Ig 153..217 CDD:143165
IG_like 248..326 CDD:214653
IGc2 254..315 CDD:197706
IGc2 350..418 CDD:197706
IG_like 450..535 CDD:214653
IGc2 455..515 CDD:197706
Ig 541..622 CDD:299845
IG_like 543..631 CDD:214653
MAM 753..917 CDD:279023 45/188 (24%)
MAM 753..916 CDD:99706 45/188 (24%)
Sr-CIIINP_524747.1 CCP 27..>62 CDD:153056
MAM 143..310 CDD:279023 43/182 (24%)
MAM 143..310 CDD:99706 43/182 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.