DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MDGA1 and Sr-CII

DIOPT Version :9

Sequence 1:XP_006715119.1 Gene:MDGA1 / 266727 HGNCID:19267 Length:973 Species:Homo sapiens
Sequence 2:NP_001188908.1 Gene:Sr-CII / 44219 FlyBaseID:FBgn0020377 Length:599 Species:Drosophila melanogaster


Alignment Length:246 Identity:70/246 - (28%)
Similarity:99/246 - (40%) Gaps:40/246 - (16%)


- Green bases have known domain annotations that are detailed below.


Human   745 SPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQNALTQNPKRSPNTGPPTD--ISGTPEGYYMFIE 807
            |.:..|::|.||.|..||::.:.|....|.|.:|:|.  ...|.|||..|  ...|..|:||.:|
  Fly   128 SNHTMDHSCDFESEDQCGWSAEETIWLPWKRISAVTD--FHHPRTGPRYDHTFGNTSGGHYMRME 190

Human   808 TSRPRELGDRARLVSPLYNASAKF---YCVSFFYHMYGKHIGSLNLLVRSR--------NKGALD 861
            |.  .|.......|||:|..|...   .|..|.|.|:|..:..|.|.|:..        |....:
  Fly   191 TQ--IEAYGSYHFVSPVYPRSLCLNVACCFRFHYFMFGAGVDRLVLSVKPASLQIDDMWNSFRSN 253

Human   862 THAWSLSGNKGNVWQQAHVPISP-SGPFQIIFEGVRGPGYLGDIAIDDVTLKKG-ECPRKQTDP- 923
            :..:.::|::|..|.:..:.|.. ...||::|.........||||||||.|..| ||   ..|. 
  Fly   254 SSKFEITGSQGTHWLENTITIDKMHEDFQVVFTATDARSQFGDIAIDDVKLMTGSEC---GVDGY 315

Human   924 NKGARREGGGGAESGG---------SCAWRGFLSVEGGCLGLNRGSECLSD 965
            :.....|....|.|..         ||.:|        |..::.||...||
  Fly   316 STTTTTESASSAMSSSEEPLVFDMMSCTFR--------CGSISPGSPLFSD 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MDGA1XP_006715119.1 IG_like 46..126 CDD:214653
IGc2 52..115 CDD:197706
IG_like 152..217 CDD:214653
Ig 153..217 CDD:143165
IG_like 248..326 CDD:214653
IGc2 254..315 CDD:197706
IGc2 350..418 CDD:197706
IG_like 450..535 CDD:214653
IGc2 455..515 CDD:197706
Ig 541..622 CDD:299845
IG_like 543..631 CDD:214653
MAM 753..917 CDD:279023 55/178 (31%)
MAM 753..916 CDD:99706 54/177 (31%)
Sr-CIINP_001188908.1 CCP 22..72 CDD:153056
CCP 77..125 CDD:214478
MAM 136..312 CDD:279023 56/182 (31%)
MAM 136..308 CDD:99706 53/175 (30%)
Somatomedin_B 341..387 CDD:279385 8/26 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9778
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.