DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ptpn9 and Ptp61F

DIOPT Version :9

Sequence 1:NP_001013058.1 Gene:Ptpn9 / 266611 RGDID:628726 Length:593 Species:Rattus norvegicus
Sequence 2:NP_476687.1 Gene:Ptp61F / 38160 FlyBaseID:FBgn0267487 Length:548 Species:Drosophila melanogaster


Alignment Length:277 Identity:104/277 - (37%)
Similarity:151/277 - (54%) Gaps:22/277 - (7%)


- Green bases have known domain annotations that are detailed below.


  Rat   304 YEEY-EDIRRENPVGTFHCSMSPGNLEK--NRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDG 365
            |:|. |...||.....|..|.|..:..:  |||.||...|.:|:.|.:.|    .|||||:.:..
  Fly    34 YKEICETCDREAKEKQFSTSESERHTNRGLNRYRDVNPYDHSRIVLKRGS----VDYINANLVQL 94

  Rat   366 YKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLE----KDSRIQF 426
            .:.:..||.|||||.:|...|||||||||...::|..:..|..:.||..|||.|    |..::..
  Fly    95 ERAERQYILTQGPLVDTVGHFWLMVWEQKSRAVLMLNKLMEKKQIKCHLYWPNEMGADKALKLPH 159

  Rat   427 GFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRSQQ 491
            ..|||..:.:|...::.:...::.:.|.:|.|:|..|.:.:|||:|:|||..:.:.||:.||.. 
  Fly   160 VKLTVELVRLETYQNFVRRWFKLTDLETQQSREVMQFHYTTWPDFGIPSSPNAFLKFLQQVRDS- 223

  Rat   492 SMAVGSLGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAF 556
                |.| :|..|     |.||||||||||:||||.:|.||..:::.|..||.:.:..:|:.|..
  Fly   224 ----GCL-SRDVG-----PAVVHCSAGIGRSGTFCLVDCCLVLIDKYGECNVSKVLCELRSYRMG 278

  Rat   557 SIQTPEQYYFCYKAILE 573
            .|||.:|..|.|:||:|
  Fly   279 LIQTADQLDFSYQAIIE 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ptpn9NP_001013058.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
CRAL_TRIO_N 20..66 CDD:215024
SEC14 90..238 CDD:214706
PTPc 302..573 CDD:214550 103/275 (37%)
PTPc 329..573 CDD:238006 95/249 (38%)
Substrate binding. /evidence=ECO:0000250 515..521 5/5 (100%)
Ptp61FNP_476687.1 PTPc 34..295 CDD:214550 103/275 (37%)
PTPc 62..295 CDD:238006 95/247 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000704
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.