DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDF10 and scw

DIOPT Version :9

Sequence 1:NP_004953.1 Gene:GDF10 / 2662 HGNCID:4215 Length:478 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:398 Identity:85/398 - (21%)
Similarity:137/398 - (34%) Gaps:126/398 - (31%)


- Green bases have known domain annotations that are detailed below.


Human    97 NTVRSFRARL--EVVDQKAVYF--FNLTSMQDSEMILTATFHFYSEPPRWPRALEVLCKPRAKNA 157
            |::.:|.:||  |.:|.:....  ||...:.....::.|....|.:|....|..........|  
  Fly   111 NSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRANFTVSVYRK-- 173

Human   158 SGRPLPLGPPTRQHLLFRSL-SQNTATQGLLRGAMALAPPPRGLWQAKDISPIV------KAARR 215
                    ...||...:|.| |.||.:.            .|| |...:::..:      |..:|
  Fly   174 --------LDNRQDFSYRILGSVNTTSS------------QRG-WLEFNLTDTLRYWLHNKGLQR 217

Human   216 DGELLLS---AQLDSEERDPGVPRPS--PYAPYILVYANDLAISEPNSVAVTLQRYDPFPAGDPE 275
            ..||.:|   :||.:.......|:.|  ...|:|:.|.|...:    .|.:...|:    ..|.|
  Fly   218 RNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPEL----LVKIQKLRF----KRDLE 274

Human   276 PRAAPNNSADPRVRRAAQATGPLQDNELPGLDERPPRAHAQHFHKHQLWPSPFRALKPRPGRKDR 340
            .|.|...|..|                       ||             |.|....:|       
  Fly   275 KRRAGGGSPPP-----------------------PP-------------PPPVDLYRP------- 296

Human   341 RKKGQEVFMAASQVLDFDEKTMQKARRKQWDEPRVCSRRYLKVDFADIGWNEWIISPKSFDAYYC 405
                                            |:.|.|....|||.::..:.|:|:||.|:||:|
  Fly   297 --------------------------------PQSCERLNFTVDFKELHMHNWVIAPKKFEAYFC 329

Human   406 AGACEFPMPKIVRPSNHATIQSIVRAVGIIPGIPEPCCVPDKMNSLGVL-FLDENRNVVLKVYPN 469
            .|.|.||:...:..:|||.:|:::....  |.:|:|||||..:.::.:| :|:|: .:.|..|..
  Fly   330 GGGCNFPLGTKMNATNHAIVQTLMHLKQ--PHLPKPCCVPTVLGAITILRYLNED-IIDLTKYQK 391

Human   470 MSVDTCAC 477
            .....|.|
  Fly   392 AVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDF10NP_004953.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..319 8/52 (15%)
TGF_beta 374..477 CDD:278448 34/103 (33%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 34/165 (21%)
TGFB 300..400 CDD:214556 35/103 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.