DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GDF2 and scw

DIOPT Version :9

Sequence 1:NP_057288.1 Gene:GDF2 / 2658 HGNCID:4217 Length:429 Species:Homo sapiens
Sequence 2:NP_001286088.1 Gene:scw / 46000 FlyBaseID:FBgn0005590 Length:400 Species:Drosophila melanogaster


Alignment Length:427 Identity:95/427 - (22%)
Similarity:160/427 - (37%) Gaps:127/427 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    63 KVDFLRSLNLSGVPSQDKTRVEP------PQYMIDLYNRYTSDKSTTPASNIVRSFSMEDAISIT 121
            :::.:..|:|...|   :.:.||      .::::::||..:.|:......:.....|::|.|.|:
  Fly    39 QMEMIDILDLGDRP---RRQAEPNLHNSASKFLLEVYNEISEDQEPKEVLHQRHKRSLDDDILIS 100

Human   122 ATE----------------------DFPFQKHILLFNISIPRHEQITRAELRLY----------- 153
            ..:                      |.....||......:|....:.:|.||:|           
  Fly   101 NEDRQEIASCNSILTFSSRLKPEQLDNELDMHITFNTNDVPVDLSLVQAMLRIYKQPSLVDRRAN 165

Human   154 --VSCQNHVDPSHDLKGSVVIYDVLDGTDAWDSATETKTFLVSQDIQDEGWETLEVSSAVKRWVR 216
              ||....:|...|..     |.:|...:...|              ..||....::..::.|:.
  Fly   166 FTVSVYRKLDNRQDFS-----YRILGSVNTTSS--------------QRGWLEFNLTDTLRYWLH 211

Human   217 SDSTKSKNKLEVTVESHRKGCDTLDISVPPGSRNL--PFFVVFSNDHSSGTKETRLELREMISHE 279
            :...:.:|:|.:::...:.......:..|..||..  ||.|.:.|......|..:|..:..:   
  Fly   212 NKGLQRRNELRISIGDSQLSTFAAGLVTPQASRTSLEPFIVGYFNGPELLVKIQKLRFKRDL--- 273

Human   280 QESVLKKLSKDGSTEAGESSHEEDTDGHVAAGSTLARRKRSAGAGS----------------HCQ 328
                                                 .||.||.||                .|:
  Fly   274 -------------------------------------EKRRAGGGSPPPPPPPPVDLYRPPQSCE 301

Human   329 KTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACC 393
            :.:..|:|:::...:|:||||::|||.|.|||.|||...:..|.|||||||:|||.| .:.|.||
  Fly   302 RLNFTVDFKELHMHNWVIAPKKFEAYFCGGGCNFPLGTKMNATNHAIVQTLMHLKQP-HLPKPCC 365

Human   394 VPTKLSPISVL-YKDDMGVPTLKYHYEGMSVA-ECGC 428
            |||.|..|::| |.::..:...||.   .:|| ||||
  Fly   366 VPTVLGAITILRYLNEDIIDLTKYQ---KAVAKECGC 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GDF2NP_057288.1 TGFb_propeptide 76..257 CDD:279078 36/223 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..308 0/24 (0%)
TGF_beta 326..428 CDD:278448 46/103 (45%)
Interaction with ENG. /evidence=ECO:0000269|PubMed:28564608 402..416 2/14 (14%)
scwNP_001286088.1 TGFb_propeptide 39..254 CDD:279078 38/236 (16%)
TGFB 300..400 CDD:214556 48/104 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3900
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.