DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PCOLCE2 and tld

DIOPT Version :9

Sequence 1:NP_037495.1 Gene:PCOLCE2 / 26577 HGNCID:8739 Length:415 Species:Homo sapiens
Sequence 2:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster


Alignment Length:332 Identity:99/332 - (29%)
Similarity:156/332 - (46%) Gaps:68/332 - (20%)


- Green bases have known domain annotations that are detailed below.


Human    33 CGG--ILTGESGFIGSEGFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCRYDFVDVYN 95
            |||  .||.:.. |.|..:|..|.|:.:|.|:||.|:...|.|.|:..:||..:.|.||||::.:
  Fly   478 CGGDLKLTKDQS-IDSPNYPMDYMPDKECVWRITAPDNHQVALKFQSFELEKHDGCAYDFVEIRD 541

Human    96 G-HANGQRIGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMA--MFSAAEP--NERGDQY-- 153
            | |::.:.||||||...|..:.:..|:|.::.:||::....||.|  |....|.  .:.|.|:  
  Fly   542 GNHSDSRLIGRFCGDKLPPNIKTRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFTDHGCQHLC 606

Human   154 ---------------------------CGGLLD--RPSGSFKTPNWPDRDYPAGVTCVWHIVAPK 189
                                       |||::|  :.:||..:|::|| .||....|||.:|||.
  Fly   607 INTLGSYQCGCRAGYELQANGKTCEDACGGVVDATKSNGSLYSPSYPD-VYPNSKQCVWEVVAPP 670

Human   190 NQLIELKFEKFDVE--RDNY--CRYDYVAVFNGGEVNDARRIGKYCGDSPPAPIVSERNELLIQF 250
            |..:.|.|..||:|  |.:|  |.|||:.:::....|..::||.|||...|..:.||::.|.::|
  Fly   671 NHAVFLNFSHFDLEGTRFHYTKCNYDYLIIYSKMRDNRLKKIGIYCGHELPPVVNSEQSILRLEF 735

Human   251 LSDLSLTADGFIGHYIFRPKKLPTTTEQPVTTTFPVTTGLKPTVALCQQKCRRTGTLEGNY---C 312
            .||.::...||:..::....:.....                  ..||.:||.|   .|:|   |
  Fly   736 YSDRTVQRSGFVAKFVIDVDECSMNN------------------GGCQHRCRNT---FGSYQCSC 779

Human   313 SSDFVLA 319
            .:.:.||
  Fly   780 RNGYTLA 786

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PCOLCE2NP_037495.1 CUB 33..143 CDD:238001 42/114 (37%)
CUB 154..267 CDD:238001 44/118 (37%)
NTR_PCOLCE 292..415 CDD:239631 10/31 (32%)
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808
Astacin 144..339 CDD:279708
CUB 388..474 CDD:214483
CUB 478..586 CDD:278839 40/108 (37%)
FXa_inhibition 595..630 CDD:291342 2/34 (6%)
CUB 634..750 CDD:278839 44/116 (38%)
FXa_inhibition 757..792 CDD:291342 10/51 (20%)
CUB 797..906 CDD:278839
CUB 910..1023 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.993157 Normalized mean entropy S7146
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.