DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RGS17 and Axn

DIOPT Version :9

Sequence 1:NP_036551.3 Gene:RGS17 / 26575 HGNCID:14088 Length:210 Species:Homo sapiens
Sequence 2:NP_733336.1 Gene:Axn / 43565 FlyBaseID:FBgn0026597 Length:745 Species:Drosophila melanogaster


Alignment Length:194 Identity:41/194 - (21%)
Similarity:90/194 - (46%) Gaps:34/194 - (17%)


- Green bases have known domain annotations that are detailed below.


Human    43 VRNEERGENAG-RPTHTTKMESIQVLEECQNPTAE----EVLSWSQNFDKMMKAPAGRNLFREFL 102
            :|..:..|.:| ||....:...::.:.|....|::    ..|:|::..:.:::...|..||::::
  Fly     8 IRKHDDNECSGPRPPVPGEESRVKKMTEGVADTSKNSSPSYLNWARTLNHLLEDRDGVELFKKYV 72

Human   103 RTE---YSEENLLFWLACEDLKKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLL 164
            ..|   |: ::|.|:.|||.||::.:.:.|::....||.    .|...::|:...:|..|.....
  Fly    73 EEEAPAYN-DHLNFYFACEGLKQQTDPEKIKQIIGAIYR----FLRKSQLSISDDLRAQIKAIKT 132

Human   165 DP----NPHMYEDAQLQIYTLMHRDSFPRFLNSQIYKSFVE-----------------STAGSS 207
            :|    :||:::..|..:...:..:.:|.||.|::|..:::                 .:||||
  Fly   133 NPEIPLSPHIFDPMQRHVEVTIRDNIYPTFLCSEMYILYIQQMSAQQERCTSSGATGSGSAGSS 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RGS17NP_036551.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
RGS 41..197 CDD:413378 36/165 (22%)
AxnNP_733336.1 RGS 55..170 CDD:295367 28/119 (24%)
Axin_b-cat_bind 494..543 CDD:285982
DIX 665..739 CDD:279160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.