DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TSPAN16 and Tsp29Fa

DIOPT Version :9

Sequence 1:NP_036598.1 Gene:TSPAN16 / 26526 HGNCID:30725 Length:245 Species:Homo sapiens
Sequence 2:NP_001162915.1 Gene:Tsp29Fa / 34211 FlyBaseID:FBgn0032074 Length:248 Species:Drosophila melanogaster


Alignment Length:239 Identity:56/239 - (23%)
Similarity:110/239 - (46%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


Human     9 SSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNLCLVMGCITVLLGC 73
            :::|..|...|....::||||:.:|.|   .||..|......:.....:....:|:|...:::..
  Fly     9 NAVKYTLFGFNLIFLITGIILIAVGAG---VGAVYTGYKLFLAGKFFSIPTFLIVIGSFIIIISF 70

Human    74 AGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVA-LEHTFVTLRKN-YRGYNE 136
            .|.:||.||:...:|...:.:.|:.|:|:.|.   :..:.:..|.: |..|.:|...| |...| 
  Fly    71 FGCWGALKENYCLVLSFSVMLAIIFILELAAG---ISGYVLRNDASDLIKTSLTYSLNEYNSIN- 131

Human   137 PDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCCK----SIGSVSCDGRDVSPNV 197
            |:..:..|:.:.::.:||||.:|.|:. ::|   .....|.|||.    ::|:.:|:....|...
  Fly   132 PNATTKLWDDIQDEFECCGVTSYNDWI-TAF---PNGDLPISCCNVHVGAVGTFTCNNAQSSVAD 192

Human   198 IHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRWG---SRYVAQ 238
            .|:.||...........:.:|..:.:..|::|.:|   :.|:|:
  Fly   193 RHKVGCLDGFSGYISAHAVSLGAAGVVIAILQFFGVIFACYIAR 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TSPAN16NP_036598.1 Tetraspannin 19..232 CDD:278750 51/218 (23%)
uroplakin_I_like_LEL 120..215 CDD:239409 25/99 (25%)
Tsp29FaNP_001162915.1 Tetraspannin 11..238 CDD:278750 56/237 (24%)
tetraspanin_LEL 106..210 CDD:239401 26/108 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3882
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.