DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TIMM9 and Tim9b

DIOPT Version :10

Sequence 1:NP_036592.1 Gene:TIMM9 / 26520 HGNCID:11819 Length:89 Species:Homo sapiens
Sequence 2:NP_001027074.1 Gene:Tim9b / 3772213 FlyBaseID:FBgn0027358 Length:117 Species:Drosophila melanogaster


Alignment Length:53 Identity:17/53 - (32%)
Similarity:30/53 - (56%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    11 IKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRI 63
            ::..|:|...|||:||.||..||.:.:.|::...|..|.:.|:.|:.:..|.:
  Fly     5 LRNLKDFFTLYNKVTELCFSRCVDNLSQRDLGGHEDLCVDRCVTKFARFNQNM 57

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TIMM9NP_036592.1 zf-Tim10_DDP 10..69 CDD:460764 17/53 (32%)
Twin CX3C motif 28..52 7/23 (30%)
Tim9bNP_001027074.1 zf-Tim10_DDP 4..61 CDD:460764 17/53 (32%)

Return to query results.
Submit another query.