DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW and tkr-1

DIOPT Version :9

Sequence 1:NP_000504.1 Gene:OPN1MW / 2652 HGNCID:4206 Length:364 Species:Homo sapiens
Sequence 2:NP_499064.2 Gene:tkr-1 / 192055 WormBaseID:WBGene00006576 Length:406 Species:Caenorhabditis elegans


Alignment Length:309 Identity:79/309 - (25%)
Similarity:124/309 - (40%) Gaps:68/309 - (22%)


- Green bases have known domain annotations that are detailed below.


Human    61 IFVVIA-------SVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVI-ASTISVVNQVYG 117
            :||.||       ::..|.:|:....:.|.:.:..|:.|.|:|.|||...:. ..|....|..|.
 Worm    44 VFVAIAFVLLMATAIIGNSVVMWIIYQHKVMHYGFNYFLFNMAFADLLIALFNVGTSWTYNLYYD 108

Human   118 YFVLGHPMCVLEGY------TVSLCGITGLWSLAIISWERWMVVCKPFGNVRFDAKLAIVGIAFS 176
            ::.  ..:|.|..:      |||:|      |:..:||:|...|..|........|.:::.|...
 Worm   109 WWY--GDLCTLTSFFGIAPTTVSVC------SMMALSWDRCQAVVNPLQKRPLSRKRSVIAILII 165

Human   177 WIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITP---------- 231
            |:.:.| ||.|.             :....|.|..:|..|.|  .|.....|..|          
 Worm   166 WVVSTV-TALPF-------------AIAASVNSLYTYDVVTS--TVSKAHVCSAPVNTFFEKVLF 214

Human   232 -----LSIIVL--CYLQVWLAIRAV--AKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPYAFF 287
                 |.||:|  .:.::.:|.||.  |.......:..:|:.:..:|:.:||:||..||.||..:
 Worm   215 GIQYALPIIILGSTFTRIAVAFRATNEATDSSLKNNHTRAKSKAVKMLFLMVVAFVVCWLPYHIY 279

Human   288 ACFA------AANPGYPFHPLMAALPAFFAKSATIYNPVIYVFMNRQFR 330
            ..||      ||...|.:     .|..:.|.|:..|||:||.|.|.:||
 Worm   280 HAFALEEFFDAARGKYAY-----LLIYWIAMSSCAYNPIIYCFANERFR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MWNP_000504.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43
7tm_4 61..>178 CDD:304433 31/130 (24%)
7tm_1 71..322 CDD:278431 69/282 (24%)
tkr-1NP_499064.2 7tm_4 58..330 CDD:304433 75/295 (25%)
7tm_1 60..315 CDD:278431 69/283 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.