DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW and npr-14

DIOPT Version :9

Sequence 1:NP_000504.1 Gene:OPN1MW / 2652 HGNCID:4206 Length:364 Species:Homo sapiens
Sequence 2:NP_001379223.1 Gene:npr-14 / 189211 WormBaseID:WBGene00012275 Length:425 Species:Caenorhabditis elegans


Alignment Length:381 Identity:81/381 - (21%)
Similarity:144/381 - (37%) Gaps:76/381 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    17 DSYEDSTQSSIFTYTNSNSTRGPFEGPNYHIAPRW-VYHLTSVWMIFVVIASVFTNGLVLAATMK 80
            :.|||....:::              ||  ...:| ||.|.|:.:|     .|..|.||:.....
 Worm    30 EEYEDIIAEALW--------------PN--AVEQWFVYILASMMVI-----GVIGNTLVVVVVAT 73

Human    81 FKKLRHPLNWILVNLAVADLAETVIASTISVVNQVYGYFVLGHPMCVLEGYTVSLCGITGLWSLA 145
            .|.:|:.||.:|:|||:|||...:....::|||.|...|......|....:..:......:.||.
 Worm    74 NKSMRNALNLVLMNLAIADLLILLFCLPLTVVNDVTKTFWFSAVFCKSVNFVNNTSVYVSIMSLV 138

Human   146 IISWERWMVVCKPFGNVRFDAKLAIVGIAFSWIWAAVWTAP-PIF-----------GWSRYWPHG 198
            .|:.|||..:..|..:.....:..|.||   |..|...::| |:.           .::..|...
 Worm   139 FITCERWRAITYPLKSPFVRTRSVIGGI---WFIAMFLSSPEPVTLHLAGAPFVRPNFTTKWGTR 200

Human   199 LKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAE 263
            .|.|...:.        .::|.::..:...:.||.:|.:..|.:...:...|.....:.......
 Worm   201 CKESWSEEF--------QKNYQLLQTIFSFVLPLLVISILCLHMVRTLHFSANYLTVANRQISIR 257

Human   264 KEVTRMVVVMVLAFCFCWGP---------YAFFACFAAANPGYPFHPLMAALPAFFAKSATIYNP 319
            |:..||:..:|..|.....|         |...:...:.|.    ..:...||..|:.|::..||
 Worm   258 KKAVRMLCAVVFLFSMSNLPVHLYNIALNYDLLSTDVSTNT----IAVRKLLPRVFSYSSSCLNP 318

Human   320 VIYVFMNRQFRNCILQLFGKKV----DDGSE----------LSSASKTEVSSVSSV 361
            ::|.|::.:||    :.||:.|    |:.|.          .:|:.:...:|.|::
 Worm   319 ILYSFLSGRFR----EEFGRVVCCLRDEKSSREFRRKQASLYASSQRVRTNSCSTM 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MWNP_000504.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 3/5 (60%)
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43 3/25 (12%)
7tm_4 61..>178 CDD:304433 32/116 (28%)
7tm_1 71..322 CDD:278431 57/271 (21%)
npr-14NP_001379223.1 7tmA_CCKR-like 48..332 CDD:320124 68/307 (22%)
TM helix 1 49..73 CDD:320124 9/28 (32%)
TM helix 2 82..104 CDD:320124 8/21 (38%)
TM helix 3 120..142 CDD:320124 3/21 (14%)
TM helix 4 161..177 CDD:320124 5/18 (28%)
TM helix 5 211..234 CDD:320124 4/22 (18%)
TM helix 6 261..283 CDD:320124 5/21 (24%)
TM helix 7 300..325 CDD:320124 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.