DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW and frpr-16

DIOPT Version :9

Sequence 1:NP_000504.1 Gene:OPN1MW / 2652 HGNCID:4206 Length:364 Species:Homo sapiens
Sequence 2:NP_495204.1 Gene:frpr-16 / 187838 WormBaseID:WBGene00020023 Length:340 Species:Caenorhabditis elegans


Alignment Length:381 Identity:75/381 - (19%)
Similarity:141/381 - (37%) Gaps:122/381 - (32%)


- Green bases have known domain annotations that are detailed below.


Human    50 RWVYHLTSVWM----IFVVIASVFTNGLVL-AATMKFKKLRHPLNWILVNLAVADLAETVIASTI 109
            |:.::....||    ||:.:...|.:.||. .|.|:    :..:..:|:.|::.|:...::.:.|
 Worm     3 RYEFYELKSWMYLPVIFIGLLGNFASFLVYRTAPMR----KSTVGTLLLILSLIDILLLILITPI 63

Human   110 SVVN---------QVYGYFV--------LGHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCK 157
            .|:.         |.|.:.:        ..:|:|::    ...|   .|:.:.:|:.|||:.||:
 Worm    64 FVLVFLPLWQDQWQKYSFHMSFFAYSTRYVYPLCMM----TKSC---SLYLMVLITIERWIAVCR 121

Human   158 PFGNVRFDAKLAI-------VGIAFSWIWAAVWTAPPIFGW-------SRYWPHGLKTSCGPDVF 208
            |     ..||:..       .|| |..|::.|:..|..|.:       |..|....:......:|
 Worm   122 P-----LQAKVLCTNRNTMKAGI-FIIIFSIVFNFPRFFDYKIGDGYLSEMWMLDTEKHWWYFMF 180

Human   209 SGSSYPGVQSYMIVLMVTC-CITPLSIIVLCYLQVWLAIRAVAKQQKESEST-----QKAEKEVT 267
                      |.|:|.|.. ...|..|:.:....|   |||:  |:.:...|     ::.:::.|
 Worm   181 ----------YFIILSVIFDYFLPFLIMTIANYHV---IRAL--QESDEVITGLAVQKRKDQKTT 230

Human   268 RMVVVMVLAFCFC------------------------WGPYAFFACFAAANPGYPFHPLMAALPA 308
            .|::|:.:.|.||                        |..:|.|..|.                .
 Worm   231 VMLLVVTIFFAFCHLFSMFLKVAESIFGGFLTQTSFYWEVFAEFTIFL----------------I 279

Human   309 FFAKSATIYNPVIYVFMNRQFRNCILQLF--GKKVDDGSELSSASKTEVSSVSSVS 362
            .|..|:|.:   ||...:.:||.....:.  .:::||   :..::...|:|..:||
 Worm   280 IFHTSSTFF---IYYGFSEKFRTIFHDIIRCRQRLDD---VKCSTYLPVNSSGAVS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MWNP_000504.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43
7tm_4 61..>178 CDD:304433 30/141 (21%)
7tm_1 71..322 CDD:278431 59/312 (19%)
frpr-16NP_495204.1 7tmA_FMRFamide_R-like 13..301 CDD:320109 67/338 (20%)
TM helix 1 13..34 CDD:320109 6/20 (30%)
TM helix 2 48..70 CDD:320109 4/21 (19%)
TM helix 3 91..113 CDD:320109 5/28 (18%)
TM helix 4 136..152 CDD:320109 5/16 (31%)
TM helix 5 180..203 CDD:320109 7/32 (22%)
TM helix 6 227..252 CDD:320109 6/24 (25%)
TM helix 7 269..294 CDD:320109 8/43 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.