DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment OPN1MW and frpr-11

DIOPT Version :9

Sequence 1:NP_000504.1 Gene:OPN1MW / 2652 HGNCID:4206 Length:364 Species:Homo sapiens
Sequence 2:NP_001343679.1 Gene:frpr-11 / 187065 WormBaseID:WBGene00019444 Length:370 Species:Caenorhabditis elegans


Alignment Length:352 Identity:69/352 - (19%)
Similarity:140/352 - (39%) Gaps:66/352 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    53 YHLTSVW---MIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIA-------- 106
            |.:..|:   |:.:::..:|.|.:.:....:....::.:.::|::|:..||...:.|        
 Worm    31 YDMVEVFAMIMLPLILIGIFGNIISIYVYSRHHMNKNTIGFLLLSLSTIDLIVLITAMPSFGTYK 95

Human   107 -------STISVVNQVYGYFVLGHPMCVLEGYTVSLCG-ITGLWSLAIISWERWMVVCKPF---- 159
                   ..|..|:.::..|      |::..|.:...| :.|.:.:.:||.|||..||:|.    
 Worm    96 FPFFPGYHEIGSVHTIFSAF------CLIYFYPLMCMGKMMGQYIIVLISVERWFAVCRPLQVQI 154

Human   160 -----GNVRFDAKLAIVGIAFSWIWAAVWTAPPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSY 219
                 ..:|  |...|:.|:.      ::.||..|.:......|: ...|....|.:.:.....|
 Worm   155 WCTQKNTIR--AMTCIIAISI------LFNAPRFFEFKANLITGV-IGFGLAHISKNEWYFYLYY 210

Human   220 MIVLMVTCCITPLSIIVLCYLQVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVLAFCFCWGPY 284
            .|..::...:.|.|||.:..:||...:|...:::|...:.|:.:.:.|.|::||:..:..|    
 Worm   211 GIRAIIFDALIPFSIIAVTNIQVIQQLRKSNEERKLMTTQQQKDNKTTTMLLVMIFMYAIC---- 271

Human   285 AFFAC--------FAAANPGYPF------HPLMAALPAFFAKSATIYNPVIYVFMNRQFRNCILQ 335
             .|.|        |:.....:.|      |.:...|..|::.| |.:   ||:..:.::||.:..
 Worm   272 -HFLCTSVKFINLFSHNYVQFQFVIFKIIHHISNVLLVFYSAS-TFF---IYLIFSEKYRNVLST 331

Human   336 LFGKKVDDGSELSSASKTEVSSVSSVS 362
            ....:..|...:||..:....:..|.|
 Worm   332 CVTCRNTDELTVSSRGRQNTKTTRSNS 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OPN1MWNP_000504.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43
7tm_4 61..>178 CDD:304433 26/141 (18%)
7tm_1 71..322 CDD:278431 56/289 (19%)
frpr-11NP_001343679.1 7tmA_FMRFamide_R-like 36..329 CDD:320109 63/316 (20%)
TM helix 1 37..61 CDD:320109 3/23 (13%)
TM helix 2 70..92 CDD:320109 5/21 (24%)
TM helix 3 118..140 CDD:320109 4/21 (19%)
TM helix 4 163..179 CDD:320109 5/23 (22%)
TM helix 5 208..231 CDD:320109 6/22 (27%)
TM helix 6 255..280 CDD:320109 7/29 (24%)
TM helix 7 297..322 CDD:320109 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.