| Sequence 1: | NP_000504.1 | Gene: | OPN1MW / 2652 | HGNCID: | 4206 | Length: | 364 | Species: | Homo sapiens |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001359889.1 | Gene: | dop-6 / 180706 | WormBaseID: | WBGene00016037 | Length: | 692 | Species: | Caenorhabditis elegans |
| Alignment Length: | 210 | Identity: | 50/210 - (23%) |
|---|---|---|---|
| Similarity: | 93/210 - (44%) | Gaps: | 27/210 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Human 47 IAPRWVYHLTSVWMIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISV 111
Human 112 ---VNQVYGYFVLGHPMCVLEGYTV--SLCGITGLWSLAIISWERWMVVCKP--FGNVRFDAKLA 169
Human 170 IVGIAFSWIWAAVWTAPPIFGWSRYWPHGL--KTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPL 232
Human 233 SIIVLCYLQVWLAIR 247 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| OPN1MW | NP_000504.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
| Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 | 17..43 | ||||
| 7tm_4 | 61..>178 | CDD:304433 | 33/123 (27%) | ||
| 7tm_1 | 71..322 | CDD:278431 | 45/186 (24%) | ||
| dop-6 | NP_001359889.1 | 7tmA_amine_R-like | 24..>217 | CDD:320098 | 49/206 (24%) |
| TM helix 1 | 25..49 | CDD:320098 | 7/27 (26%) | ||
| TM helix 2 | 58..80 | CDD:320098 | 8/21 (38%) | ||
| TM helix 3 | 97..119 | CDD:320098 | 4/21 (19%) | ||
| TM helix 4 | 142..158 | CDD:320098 | 4/15 (27%) | ||
| TM helix 5 | 181..204 | CDD:320098 | 4/22 (18%) | ||
| 7tm_GPCRs | <464..542 | CDD:391938 | |||
| TM helix 6 | 466..496 | CDD:341315 | |||
| TM helix 7 | 513..535 | CDD:341315 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||