Sequence 1: | NP_000504.1 | Gene: | OPN1MW / 2652 | HGNCID: | 4206 | Length: | 364 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001256126.1 | Gene: | dop-2 / 179347 | WormBaseID: | WBGene00001053 | Length: | 849 | Species: | Caenorhabditis elegans |
Alignment Length: | 265 | Identity: | 58/265 - (21%) |
---|---|---|---|
Similarity: | 117/265 - (44%) | Gaps: | 46/265 - (17%) |
- Green bases have known domain annotations that are detailed below.
Human 60 MIFVVIASVFTNGLVLAATMKFKKLRHPLNWILVNLAVADLAETVIASTISVVNQVY---GYFVL 121
Human 122 GHPMCVLEGYTVSLCGITGLWSLAIISWERWMVVCKP--FGNVRFDAKLAIVGIAFSWIWAAVWT 184
Human 185 APPIFGWSRYWPHGLKTSCGPDVFSGSSYPGVQSYMIVLMVTCCITPLSIIVLCYLQVWLAIR-- 247
Human 248 -AVAKQQKESES--------TQKAEKEVTRMVVVMVLAFCFCWGPYAFFACFAAANPGYPFHPLM 303
Human 304 AALPA 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
OPN1MW | NP_000504.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..23 | ||
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 | 17..43 | ||||
7tm_4 | 61..>178 | CDD:304433 | 32/121 (26%) | ||
7tm_1 | 71..322 | CDD:278431 | 57/254 (22%) | ||
dop-2 | NP_001256126.1 | 7tmA_D2-like_dopamine_R | 38..>233 | CDD:320181 | 46/199 (23%) |
TM helix 1 | 40..64 | CDD:320181 | 4/19 (21%) | ||
TM helix 2 | 73..95 | CDD:320181 | 8/21 (38%) | ||
TM helix 3 | 112..134 | CDD:320181 | 4/21 (19%) | ||
TM helix 4 | 158..174 | CDD:320181 | 3/15 (20%) | ||
TM helix 5 | 195..218 | CDD:320181 | 4/28 (14%) | ||
7tm_GPCRs | <745..828 | CDD:421689 | |||
TM helix 6 | 751..781 | CDD:410628 | |||
TM helix 7 | 796..821 | CDD:410628 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |