DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHIC2 and CG5938

DIOPT Version :9

Sequence 1:NP_036242.1 Gene:CHIC2 / 26511 HGNCID:1935 Length:165 Species:Homo sapiens
Sequence 2:NP_001097947.2 Gene:CG5938 / 43290 FlyBaseID:FBgn0046247 Length:168 Species:Drosophila melanogaster


Alignment Length:165 Identity:106/165 - (64%)
Similarity:140/165 - (84%) Gaps:1/165 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     2 ADFDEIYEEEE-DEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFK 65
            :|||.|||:|: ||....::|.:....:|:::||:|::|||||||:|.:|||..|..:|||||||
  Fly     4 SDFDAIYEDEQLDELEHFQDQTVAPVQEPIIIRGAGNMTVFGLSNRFNAEFPCGLLSRVAPEEFK 68

Human    66 ASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKL 130
            |::.|:|..|||:|||||:||.|||:|||||||||:||||||||||:.:::||.|||||.|||||
  Fly    69 ATVGRINGVLKKSLPVNVKWLFCGCVCCCCTLGCSLWPVICLSKRTQLTLDKLFEWENNHLYHKL 133

Human   131 CLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD 165
            .|||||.|::|::|:||||||||||:|||||:|||
  Fly   134 GLHWRLHKQQCDSNSMMEYVILIEFIPKTPIYRPD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHIC2NP_036242.1 Erf4 46..134 CDD:402047 60/87 (69%)
CHIC motif (Cys-rich) 88..106 15/17 (88%)
CG5938NP_001097947.2 Erf4 49..137 CDD:287258 60/87 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141026
Domainoid 1 1.000 153 1.000 Domainoid score I4290
eggNOG 1 0.900 - - E1_KOG4101
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8105
Inparanoid 1 1.050 249 1.000 Inparanoid score I3246
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG47997
OrthoDB 1 1.010 - - D1449345at2759
OrthoFinder 1 1.000 - - FOG0003641
OrthoInspector 1 1.000 - - otm41102
orthoMCL 1 0.900 - - OOG6_105429
Panther 1 1.100 - - LDO PTHR13005
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2509
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.