DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HEYL and E(spl)m3-HLH

DIOPT Version :9

Sequence 1:NP_055386.2 Gene:HEYL / 26508 HGNCID:4882 Length:328 Species:Homo sapiens
Sequence 2:NP_524509.2 Gene:E(spl)m3-HLH / 43156 FlyBaseID:FBgn0002609 Length:224 Species:Drosophila melanogaster


Alignment Length:166 Identity:42/166 - (25%)
Similarity:78/166 - (46%) Gaps:35/166 - (21%)


- Green bases have known domain annotations that are detailed below.


Human    38 SSQMQARKKHRGIIEKRRRDRINSSLSELRRLVPTAFEKQGS--SKLEKAEVLQMTVDHLKMLHA 100
            |...|.||..:.::|::||.|||..|.:|:.|:....:::|.  ::||||::|::||||::.|..
  Fly     6 SKTYQYRKVMKPLLERKRRARINKCLDDLKDLMVECLQQEGEHVTRLEKADILELTVDHMRKLKQ 70

Human   101 TGGTGF------------FDARALAVDFRSIGFRECLTEVIRYLGVLEGPSSRADPVRIRLLSHL 153
            .||...            ..:.|....||| |:.....::.:.|  |:  :.:.|.:..:::..|
  Fly    71 RGGLSLQGVVAGVGSPPTSTSTAHVESFRS-GYVHAADQITQVL--LQ--TQQTDEIGRKIMKFL 130

Human   154 NSYAAEMEPS----------------PTPTGPLAFP 173
            ::...|::..                |..:|.||||
  Fly   131 STRLIELQTQLLQQQQQQQQHQQQQIPQSSGRLAFP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HEYLNP_055386.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..57 6/18 (33%)
Transcriptional repression and interaction with NCOR1 and SIN3A. /evidence=ECO:0000250 42..111 25/82 (30%)
HLH 42..100 CDD:238036 23/59 (39%)
ORANGE 115..162 CDD:128787 9/46 (20%)
Atrophin-1 <136..311 CDD:331285 9/54 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..308
E(spl)m3-HLHNP_524509.2 HLH 11..70 CDD:238036 22/58 (38%)
ORANGE 96..136 CDD:128787 8/44 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140917
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.