DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KAT2A and nej

DIOPT Version :9

Sequence 1:NP_001363156.1 Gene:KAT2A / 2648 HGNCID:4201 Length:838 Species:Homo sapiens
Sequence 2:NP_001188575.1 Gene:nej / 43856 FlyBaseID:FBgn0261617 Length:3282 Species:Drosophila melanogaster


Alignment Length:125 Identity:35/125 - (28%)
Similarity:58/125 - (46%) Gaps:12/125 - (9%)


- Green bases have known domain annotations that are detailed below.


Human   714 ETGWKPL---------GKEKGKELKDPDQLYTTLKNLLAQI-KSHPSAWPFMEPVKKSE--APDY 766
            :|..|||         |.:|.|...:|::|.|.|...|.:: :..|.:.||..||....  .|||
  Fly  1679 KTETKPLVPEPLAPNAGDKKKKCQFNPEELRTALLPTLEKLYRQEPESVPFRYPVDPQALGIPDY 1743

Human   767 YEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFF 826
            :|:::.|:||.|:...:::..|.....:|.|:..:..|...||...|...|..:.|.:.|
  Fly  1744 FEIVKKPMDLGTIRTNIQNGKYSDPWEYVDDVWLMFDNAWLYNRKTSRVYRYCTKLSEVF 1803

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KAT2ANP_001363156.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
PCAF_N 89..335 CDD:368925
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..434
COG5076 492..833 CDD:227408 35/125 (28%)
Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269|PubMed:17410582, ECO:0000269|PubMed:29211711, ECO:0007744|PDB:5TRL 579..581
Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269|PubMed:17410582, ECO:0000269|PubMed:29211711, ECO:0007744|PDB:5TRL 586..592
Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269|PubMed:17410582, ECO:0000269|PubMed:29211711, ECO:0007744|PDB:5TRL 617..620
Loop 3. /evidence=ECO:0000269|PubMed:29211711 639..648
Bromo_gcn5_like 733..832 CDD:99941 27/97 (28%)
nejNP_001188575.1 ZnF_TAZ 530..600 CDD:214717
KIX 946..1024 CDD:280354
Bromo_cbp_like 1705..1812 CDD:99927 28/99 (28%)
RING_CBP-p300 1824..1906 CDD:276805
PHD_CBP_p300 1908..1939 CDD:277032
HAT_KAT11 1970..2283 CDD:285432
ZZ_CBP 2339..2379 CDD:239077
ZnF_TAZ 2404..2476 CDD:214717
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5076
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.