DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KAT2A and Acf

DIOPT Version :9

Sequence 1:	NP_001363156.1	Gene:	KAT2A / 2648	HGNCID:	4201	Length:	838	Species:	Homo sapiens
Sequence 2:	NP_536734.2	Gene:	Acf / 43751	FlyBaseID:	FBgn0027620	Length:	1476	Species:	Drosophila melanogaster

Alignment Length:	88	Identity:	34/88 - (38%)
Similarity:	50/88 - (56%)	Gaps:	0/88 - (0%)

- Green bases have known domain annotations that are detailed below.

Human   738 LKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVI 802
            |.:||.||..|.:||||:.||..||.|||:::|:.|:||..:..:|....|...:..::|:|.|.
  Fly  1365 LYDLLEQIMKHKAAWPFLRPVLTSEVPDYHQIIKTPMDLAKIKSKLNMGAYQLNEELLSDIQLVF 1429

Human   803 ANCREYNPPDSEYCRCASALEKF 825
            .||..||...:|.......||:|
  Fly  1430 RNCDLYNVEGNEIYDAGCQLERF 1452

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KAT2A	NP_001363156.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..99
		PCAF_N	89..335	CDD:368925
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	407..434
		COG5076	492..833	CDD:227408	34/88 (39%)
		Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269\|PubMed:17410582, ECO:0000269\|PubMed:29211711, ECO:0007744\|PDB:5TRL	579..581
		Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269\|PubMed:17410582, ECO:0000269\|PubMed:29211711, ECO:0007744\|PDB:5TRL	586..592
		Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269\|PubMed:17410582, ECO:0000269\|PubMed:29211711, ECO:0007744\|PDB:5TRL	617..620
		Loop 3. /evidence=ECO:0000269\|PubMed:29211711	639..648
		Bromo_gcn5_like	733..832	CDD:99941	34/88 (39%)
Acf	NP_536734.2	WAC_Acf1_DNA_bd	26..125	CDD:287503
		DDT	346..411	CDD:214726
		WHIM1	505..554	CDD:292246
		WHIM2	637..666	CDD:292247
		WHIM3	775..813	CDD:292248
		PHD_RSF1	1064..1109	CDD:277018
		PHD	1244..1284	CDD:214584
		Bromo_Acf1_like	1349..1463	CDD:99936	34/88 (39%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165158464
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.830