DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KAT2A and tbrd-3

DIOPT Version :9

Sequence 1:	NP_001363156.1	Gene:	KAT2A / 2648	HGNCID:	4201	Length:	838	Species:	Homo sapiens
Sequence 2:	NP_726307.1	Gene:	tbrd-3 / 246604	FlyBaseID:	FBgn0050417	Length:	268	Species:	Drosophila melanogaster

Alignment Length:	93	Identity:	28/93 - (30%)
Similarity:	43/93 - (46%)	Gaps:	11/93 - (11%)

- Green bases have known domain annotations that are detailed below.

Human   736 TTLKNLLAQIKSHPSAWPFMEPVKKS--EAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADL 798
            :|.||:         ||.|.||:...  ...||:|::|.|:||.|:..||.:..|::...|..|:
  Fly    27 STYKNI---------AWVFYEPLDPQLLGLHDYHEIVREPMDLSTVRHRLNTGCYLSAADFAKDI 82

Human   799 QRVIANCREYNPPDSEYCRCASALEKFF 826
            :.:..|...|..||......|..|:..|
  Fly    83 RLIFYNTYLYTNPDHLCYHMAKQLQIIF 110

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KAT2A	NP_001363156.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..99
		PCAF_N	89..335	CDD:368925
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	407..434
		COG5076	492..833	CDD:227408	28/93 (30%)
		Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269\|PubMed:17410582, ECO:0000269\|PubMed:29211711, ECO:0007744\|PDB:5TRL	579..581
		Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269\|PubMed:17410582, ECO:0000269\|PubMed:29211711, ECO:0007744\|PDB:5TRL	586..592
		Acetyl-CoA and acyl-CoA binding. /evidence=ECO:0000269\|PubMed:17410582, ECO:0000269\|PubMed:29211711, ECO:0007744\|PDB:5TRL	617..620
		Loop 3. /evidence=ECO:0000269\|PubMed:29211711	639..648
		Bromo_gcn5_like	733..832	CDD:99941	28/93 (30%)
tbrd-3	NP_726307.1	Bromo_Brdt_II_like	13..114	CDD:99930	28/93 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5076
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900