DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BLOC1S1 and bloc1s1

DIOPT Version :10

Sequence 1:NP_001478.2 Gene:BLOC1S1 / 2647 HGNCID:4200 Length:153 Species:Homo sapiens
Sequence 2:NP_001072249.1 Gene:bloc1s1 / 779698 XenbaseID:XB-GENE-952074 Length:125 Species:Xenopus tropicalis


Alignment Length:125 Identity:108/125 - (86%)
Similarity:113/125 - (90%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    29 MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQV 93
            ||||||||||.||.||||.|||||::||.|||.|||||||||||||||||:|||||||||||||.
 Frog     1 MLSRLLKEHQGKQTERKEAQEKRRKDAIAAATTLTEALVDHLNVGVAQAYVNQRKLDHEVKTLQT 65

Human    94 QAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS 153
            |||||||||.|||.:||||||||||||||||||||||.|||.||||||||||||||.:.|
 Frog    66 QAAQFAKQTTQWISLVENFNQALKEIGDVENWARSIEKDMRIIATALEYVYKGQLQPSAS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BLOC1S1NP_001478.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
GCN5L1 33..145 CDD:461876 97/111 (87%)
bloc1s1NP_001072249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 19/22 (86%)
GCN5L1 5..117 CDD:461876 97/111 (87%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.