DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BLOC1S1 and Bloc1s1

DIOPT Version :10

Sequence 1:NP_001478.2 Gene:BLOC1S1 / 2647 HGNCID:4200 Length:153 Species:Homo sapiens
Sequence 2:NP_001099411.2 Gene:Bloc1s1 / 288785 RGDID:1307564 Length:125 Species:Rattus norvegicus


Alignment Length:125 Identity:125/125 - (100%)
Similarity:125/125 - (100%) Gaps:0/125 - (0%)


- Green bases have known domain annotations that are detailed below.


Human    29 MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQV 93
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat     1 MLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQV 65

Human    94 QAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS 153
            ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat    66 QAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAPS 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BLOC1S1NP_001478.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
GCN5L1 33..145 CDD:461876 111/111 (100%)
Bloc1s1NP_001099411.2 GCN5L1 5..117 CDD:461876 111/111 (100%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.