DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN18 and CG42327

DIOPT Version :9

Sequence 1:XP_006712480.1 Gene:PTPN18 / 26469 HGNCID:9649 Length:464 Species:Homo sapiens
Sequence 2:NP_001036706.2 Gene:CG42327 / 41401 FlyBaseID:FBgn0259227 Length:1429 Species:Drosophila melanogaster


Alignment Length:333 Identity:103/333 - (30%)
Similarity:148/333 - (44%) Gaps:81/333 - (24%)


- Green bases have known domain annotations that are detailed below.


Human    29 EFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDVLPYDQTRVILSLLQEEGHSDYINGNFIR 93
            ||.|:....|  :||.|       .|....||||.:|:|..:|||:|....::..::|||.|::|
  Fly  1114 EFRDVPQIIA--RADEV-------PPGCEDKNRYANVIPLPETRVVLQRQGDDDKTEYINANYVR 1169

Human    94 GV-DGSLAYIATQGPLPHTLLDFWRLVWEFGVKVILMACREIENGRKRCERYWAQEQEPLQT--- 154
            |. |....|||.|.||..|..||||::||...:||:.|....|||.:||..|    ..|..|   
  Fly  1170 GPRDAPNYYIACQAPLESTTSDFWRMIWEQQSRVIIQATDLSENGIERCAEY----LPPSATLDN 1230

Human   155 ----GLFCITL----IKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAMV 211
                |.:.:||    :|:::....::|:.:.   .:|||.:....| .||:.|||:....::||:
  Fly  1231 HSSYGDYQVTLKHREVKDRYAISTLVLKRVD---GEESRELTHYWY-KWPEAGVPAEEAPIIAML 1291

Human   212 EEARR-------------------------LQGSGPE------------------------PLCV 227
            .|||.                         ..||..|                        ||.|
  Fly  1292 LEARSSLKSYSLEQANELREKSATLETSMDADGSKAEAGSTSSHEINGNISSRSGTRSQQGPLTV 1356

Human   228 HCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQYRFLYHTVAQMF 292
            |||.|.||||.:...|...:.|.|.....|..  .:|..:|:.|.:||||:|||.|:| .||.|:
  Fly  1357 HCSPGTGRTGTIIASDMAIRSLETPKRSVDIP--QLVYYVRRGRASAVQTKEQYEFIY-KVASMY 1418

Human   293 CSTLQNAS 300
            .:.:.|.|
  Fly  1419 AAKITNLS 1426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN18XP_006712480.1 Y_phosphatase 56..290 CDD:278528 91/294 (31%)
PTPc 59..290 CDD:238006 91/291 (31%)
CG42327NP_001036706.2 PTPc 1134..1415 CDD:238006 90/291 (31%)
Y_phosphatase 1134..1415 CDD:278528 90/291 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.