DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTPN18 and PTP-ER

DIOPT Version :9

Sequence 1:XP_006712480.1 Gene:PTPN18 / 26469 HGNCID:9649 Length:464 Species:Homo sapiens
Sequence 2:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster


Alignment Length:466 Identity:95/466 - (20%)
Similarity:149/466 - (31%) Gaps:223/466 - (47%)


- Green bases have known domain annotations that are detailed below.


Human    49 VAGSRPENVRKNRYKDVLPYDQTRVIL--------SLLQEEGHSD---------YINGNFIRGVD 96
            |.||:    .|||||.:||.:.:||:|        |||.|...:.         |||.|:|:|.|
  Fly   912 VFGSQ----TKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPD 972

Human    97 -GSLAYIATQGPLPHTLLDFWRLVW----------------------------EFGVKVILMACR 132
             .|..|:|||||||:|:.:||.:::                            ::..|::::. .
  Fly   973 YVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLT-N 1036

Human   133 EIENGRKRCERYWAQEQEPL-----QTGLFCITLIKEKWLN------------------------ 168
            ..|..|::|..|:..|...:     :..:|.::.....:.:                        
  Fly  1037 FTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEIS 1101

Human   169 -EDIMLRTLKVTFQ-----------------------KESRSV----------------YQLQ-- 191
             ..|.:.::|||.:                       :...||                |.||  
  Fly  1102 GRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKI 1166

Human   192 ------YMSWPDRGVPSSPD-------HMLAMVE-------------------EARRLQ------ 218
                  |..|||...|...:       |:|.:.:                   .|:||:      
  Fly  1167 YCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDI 1231

Human   219 GSGPEPL-CVHCSAGCGRTG----VLCTVDYVRQLL---LTQMI--------------------- 254
            .:..:|| .:|||||.||||    :|..|..:||.|   ||.|:                     
  Fly  1232 FNAVQPLPVIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSS 1296

Human   255 -----------------------PPDF-----------SLFDVVLKMRKQRPAAVQTEEQYRFLY 285
                                   ||.|           .:..:|..:|.||...||..|||..::
  Fly  1297 FTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIH 1361

Human   286 HTVAQMFCSTL 296
            ..:......||
  Fly  1362 RAICLYLKRTL 1372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTPN18XP_006712480.1 Y_phosphatase 56..290 CDD:278528 90/451 (20%)
PTPc 59..290 CDD:238006 90/448 (20%)
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 90/452 (20%)
PTPc 917..1364 CDD:238006 90/447 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.