DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LHX6 and ey

DIOPT Version :9

Sequence 1:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens
Sequence 2:NP_001014693.1 Gene:ey / 43812 FlyBaseID:FBgn0005558 Length:898 Species:Drosophila melanogaster


Alignment Length:336 Identity:69/336 - (20%)
Similarity:111/336 - (33%) Gaps:122/336 - (36%)


- Green bases have known domain annotations that are detailed below.


Human    28 QVMAQPGSGCKATTRCLEGTAP---------PAMAQSDAEALAGALDKD------EGQASPCTPS 77
            |..|.||....|....|.|.:|         |.:...:.:||.....:.      .|...|.:.|
  Fly   311 QHAAGPGPLEPARAAPLVGQSPNHLGTRSSHPQLVHGNHQALQQHQQQSWPPRHYSGSWYPTSLS 375

Human    78 TPSVCSPPSAAS-----SVPSAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQN 137
            ...:.|.|:.||     |.||...::.....:|.|                       .|:..|.
  Fly   376 EIPISSAPNIASVTAYASGPSLAHSLSPPNDIESL-----------------------ASIGHQR 417

Human   138 SCYIKNKEIFCKMDYFSRFGTKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFG 202
            :|.:..::|..|.:.          .|.|   ||                      :..:||   
  Fly   418 NCPVATEDIHLKKEL----------DGHQ---SD----------------------ETGSGE--- 444

Human   203 LVEEKVLCRIHYDTMIENLKRAAENGNGLTLEGA--VPSEQDSQ-----PKPAKRARTSFTAEQL 260
                                  .||.||    ||  :.:.:|.|     .:..:|.|||||.:|:
  Fly   445 ----------------------GENSNG----GASNIGNTEDDQARLILKRKLQRNRTSFTNDQI 483

Human   261 QVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRA--------RHKKHTPQHPVPPSGA 317
            ..::.:|.:.:.||....::||...||....|||||.|.||        |:::.||......:.:
  Fly   484 DSLEKEFERTHYPDVFARERLAGKIGLPEARIQVWFSNRRAKWRREEKLRNQRRTPNSTGASATS 548

Human   318 PPSRLPSALSD 328
            ..:...::|:|
  Fly   549 SSTSATASLTD 559

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766 7/52 (13%)
LIM2_Lhx6 160..214 CDD:188768 6/53 (11%)
Homeobox 252..304 CDD:278475 22/59 (37%)
eyNP_001014693.1 PAX 98..221 CDD:128645
Homeobox 475..527 CDD:278475 21/51 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6207
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.