DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psma7 and Prosalpha2

DIOPT Version :9

Sequence 1:NP_036099.1 Gene:Psma7 / 26444 MGIID:1347070 Length:248 Species:Mus musculus
Sequence 2:NP_524328.1 Gene:Prosalpha2 / 41531 FlyBaseID:FBgn0086134 Length:234 Species:Drosophila melanogaster


Alignment Length:236 Identity:90/236 - (38%)
Similarity:142/236 - (60%) Gaps:14/236 - (5%)


- Green bases have known domain annotations that are detailed below.


Mouse     3 YDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVRKICALDD 67
            |..::|.|||.|.|.|:|||..||..|:.:||:...:.||:..|.|..:.|.::.:|.::..:.:
  Fly     6 YSFSLTTFSPSGKLVQLEYALAAVSGGAPSVGIIASNGVVIATENKHKSPLYEQHSVHRVEMIYN 70

Mouse    68 NVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQSNGRRPFGISAL 132
            ::.|.::|:..|.|:::.:||...|::.||.::|:.|..:.:.:|:|.|.||||.|.||||:|.|
  Fly    71 HIGMVYSGMGPDYRLLVKQARKIAQTYYLTYKEPIPVSQLVQRVATLMQEYTQSGGVRPFGVSLL 135

Mouse   133 IVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYT-----DDAIETDDLTIKLVI 192
            |.|:|.| .|.|||:||||.|.||||.|:|:.|.:.:.||||.|:     |||:.|..||:|...
  Fly   136 ICGWDND-RPYLYQSDPSGAYFAWKATAMGKNAVNGKTFLEKRYSEDLELDDAVHTAILTLKEGF 199

Mouse   193 KALLEVVQSGGKNIELAVMRRDQ-PLKILNPEEIEKYVAEI 232
            :..:.     ..|||:.:.  || ..:.|:|..|:.|:|.|
  Fly   200 EGKMT-----ADNIEIGIC--DQNGFQRLDPASIKDYLASI 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psma7NP_036099.1 proteasome_alpha_type_7 3..211 CDD:239724 82/212 (39%)
Prosalpha2NP_524328.1 proteasome_alpha_type_2 6..231 CDD:239719 88/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.