DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Psg16 and nrm

DIOPT Version :9

Sequence 1:XP_030098466.1 Gene:Psg16 / 26436 MGIID:1347249 Length:477 Species:Mus musculus
Sequence 2:NP_001246890.1 Gene:nrm / 40515 FlyBaseID:FBgn0262509 Length:2192 Species:Drosophila melanogaster


Alignment Length:502 Identity:99/502 - (19%)
Similarity:190/502 - (37%) Gaps:108/502 - (21%)


- Green bases have known domain annotations that are detailed below.


Mouse    26 LAASLLACWLL--STTAQVTIESVPFNVVEGENVLLRVDNLPE---NLITLAWYRGLRKIVVYTL 85
            |:..|:.|..|  |:||||   ....:..|.::|:|......|   .|.:|.|::|..:|....|
  Fly    27 LSLVLVLCLALVDSSTAQV---DTTISQQESQSVVLPCPVDAEKCGKLHSLNWFKGDDRIAAMLL 88

Mouse    86 -NTKVSVMGQMYSGREIVSSNG-SLWIHNVTRKDTGLYTLRTVNRRGEIVSTSFTFLYVYTSLFI 148
             ::.|:.:.:.:..|..|..|. .|.|.::...|..:|...|.....|....:|....:...:.:
  Fly    89 GDSNVTSVNKEFDERVTVEQNPYRLVIKDLKIADEDIYLCDTTFFIPEETCDNFNGYRIELRVLV 153

Mouse   149 CGRPSFPAKLTIESVPPSVAEGGSVL------------LRVHNLQDKLRGLSWYKGAHVSRNLEI 201
               |  |.::.|........:.|||:            ..|.|.:.:.. :||::|         
  Fly   154 ---P--PTEVVILDAKGDRIKNGSVVGPMQERQSLKATCTVRNTRPQPE-VSWFRG--------- 203

Mouse   202 ARQIIAKNSSVPGPAHSGRETVYSNGSLLLQNVTRNDTGFYTLQTLSRHRKMELAHVQLQVDTSL 266
                 .|..:...|.|...:.:|::...|...::|.|        |::..:..:....:|..|..
  Fly   204 -----TKRLTTYSPTHDLVDGLYTSTLELDWTLSRED--------LAQDIECRVKSAAIQNVTVT 255

Mouse   267 SSCCD-TLDSTQLIIDPMPRYAAEGESILLR--------VLNLPEDFQVFCWYKGALIFQIFKIA 322
            ....| .:..|.:.|:.:..:..:|..::|.        .:||       .||....|.      
  Fly   256 KFSVDLQVRPTSIDINGVKHHTVQGSKVVLTCDIHGARPAVNL-------TWYNTTTII------ 307

Mouse   323 EYSRARNSITKGPAQS--RTERVYTNGSLLLQDVTEKDTGLYTLQTIDRNFKIEKAHVQIQVN-- 383
              |...|.||:..::|  :::..:...|.|:.:.|..:.        ||.|:.|..::.:|:|  
  Fly   308 --SSGENEITEVRSKSLEKSDGTFHTQSELIFNATRFEN--------DRVFRCEAENIVLQINRE 362

Mouse   384 KPVTQ---------PFMRVTDSTVRVQSS--VVFTC--FSDNTGVS-IHWLFNNQSLQLTERITL 434
            ||::.         |.::|:.|.:...:|  |:..|  |::...:: :.|..|:..:.:.:....
  Fly   363 KPISSALTLEVLYPPVVKVSPSAITANTSEIVLLNCEYFANPASLTQVEWYRNDILVNVNDTTHY 427

Mouse   435 SPSKCQ---LRINPVRKEDGGEYQCEVFN-----LASSKSSLPVSLA 473
            .....:   |.|....|||.|.|.|::.|     .:..|.:|.|..|
  Fly   428 KGGNSENVALVIKSTEKEDIGNYSCQLSNNIGKGTSDQKINLDVQYA 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Psg16XP_030098466.1 IgV_CEACAM_D1 42..139 CDD:409430 22/101 (22%)
Ig strand B 57..61 CDD:409430 2/3 (67%)
Ig strand C 70..74 CDD:409430 1/3 (33%)
Ig strand E 106..110 CDD:409430 1/4 (25%)
Ig strand F 120..125 CDD:409430 1/4 (25%)
Ig strand G 134..137 CDD:409430 0/2 (0%)
IgV_CEACAM_D1 158..262 CDD:409430 17/115 (15%)
Ig strand B 173..177 CDD:409430 1/15 (7%)
Ig strand C 186..190 CDD:409430 1/3 (33%)
Ig strand E 227..231 CDD:409430 0/3 (0%)
Ig strand F 241..246 CDD:409430 0/4 (0%)
Ig strand G 255..258 CDD:409430 0/2 (0%)
IgV_CEACAM_D1 278..382 CDD:409430 20/113 (18%)
Ig strand B 293..297 CDD:409430 1/11 (9%)
Ig strand C 306..310 CDD:409430 0/3 (0%)
Ig strand E 347..351 CDD:409430 1/3 (33%)
Ig strand F 361..366 CDD:409430 0/4 (0%)
Ig strand G 375..378 CDD:409430 0/2 (0%)
IgI_hCEACAM_2_4_6_like 388..475 CDD:409402 22/108 (20%)
Ig strand B 404..408 CDD:409402 1/3 (33%)
Ig strand C 417..421 CDD:409402 1/3 (33%)
Ig strand E 439..443 CDD:409402 1/6 (17%)
Ig strand F 453..458 CDD:409402 2/4 (50%)
Ig strand G 468..471 CDD:409402 1/2 (50%)
nrmNP_001246890.1 Ig 44..152 CDD:299845 23/110 (21%)
Ig 176..248 CDD:299845 13/94 (14%)
Ig 277..354 CDD:299845 19/99 (19%)
IG_like 383..463 CDD:214653 16/79 (20%)
Ig 394..463 CDD:143165 14/68 (21%)
Ig_3 585..652 CDD:290638
Ig 685..>719 CDD:299845
IG_like 788..869 CDD:214653
Ig <811..869 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.