DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mapk3 and bsk

DIOPT Version :9

Sequence 1:NP_036082.1 Gene:Mapk3 / 26417 MGIID:1346859 Length:380 Species:Mus musculus
Sequence 2:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster


Alignment Length:357 Identity:144/357 - (40%)
Similarity:221/357 - (61%) Gaps:31/357 - (8%)


- Green bases have known domain annotations that are detailed below.


Mouse    37 FDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKIS-PFEHQTYCQRTLREIQILLRFRHEN 100
            |.:..||..|:.||.||.|:|.:|||.:.:..|||||:| ||::.|:.:|..||.:::....|:|
  Fly    18 FTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKN 82

Mouse   101 VIGIRDILRAPT----LEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSA 161
            :||   :|.|.|    ||..:|||:|.:||:.:|.:::: ..|.:|.:.|.|||:|.|:|::|||
  Fly    83 IIG---LLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-MDLDHDRMSYLLYQMLCGIKHLHSA 143

Mouse   162 NVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKS 226
            .::||||||||:::...|.|||.||||||.|..    |..:|.||.||:|||||::| ..|||::
  Fly   144 GIIHRDLKPSNIVVKADCTLKILDFGLARTAGT----TFMMTPYVVTRYYRAPEVIL-GMGYTEN 203

Mouse   227 IDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV 291
            :||||||||:.||:....:|||..::||.|.|:..||:||...:. .:....|||:::.|..|..
  Fly   204 VDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQ-RLQPTVRNYVENRPRYTGY 267

Mouse   292 AWAKLFP-------------KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYD--PTDEP 341
            ::.:|||             :..|.|.:||.:||..:|.:||:|:|||.|.|:..:||  ..|.|
  Fly   268 SFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAP 332

Mouse   342 VAEEPFTFDMELDDLPKERLKELIFQETARFQ 373
             |.||:...::..:...|:.||||::|...::
  Fly   333 -APEPYDHSVDEREHTVEQWKELIYEEVMDYE 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mapk3NP_036082.1 STKc_ERK1_2_like 37..371 CDD:270839 144/353 (41%)
TXY 203..205 1/1 (100%)
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 142/346 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.