DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mapk14 and rl

DIOPT Version :9

Sequence 1:NP_001161980.1 Gene:Mapk14 / 26416 MGIID:1346865 Length:360 Species:Mus musculus
Sequence 2:NP_001015122.1 Gene:rl / 3354888 FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster


Alignment Length:354 Identity:168/354 - (47%)
Similarity:238/354 - (67%) Gaps:9/354 - (2%)


- Green bases have known domain annotations that are detailed below.


Mouse     2 SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAK 66
            |.|.|....:.:...|:||..||..|:.:|.||||.|.:|.||.|..|||:||:| ||:...:.:
  Fly    16 STEVPQSNAEVIRGQIFEVGPRYIKLAYIGEGAYGMVVSADDTLTNQRVAIKKIS-PFEHQTYCQ 79

Mouse    67 RTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLI 131
            ||.||:.:|...||||:|.:.|:.. ..|:::..|||:|..||..||..::|.|:|::||:.:.:
  Fly    80 RTLREITILTRFKHENIIDIRDILR-VDSIDQMRDVYIVQCLMETDLYKLLKTQRLSNDHICYFL 143

Mouse   132 YQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDE------MTGYVATRWYRA 190
            |||||||||||||:::|||||||||.:|:.|:|||.||||||..|.|      :|.|||||||||
  Fly   144 YQILRGLKYIHSANVLHRDLKPSNLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRA 208

Mouse   191 PEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPAYLINRMPSHEA 255
            ||||||...|.:::||||||||:||:|:.|.:|||..:::||..|:.:.|:|....:..:.:.:|
  Fly   209 PEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSRDDLECIINEKA 273

Mouse   256 RNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA 320
            |||::||...|.:.:|.:|..|:.||:|||.|||..:..|||...:||||.|..||:||.|||||
  Fly   274 RNYLESLPFKPNVPWAKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQYYDPGDEPVA 338

Mouse   321 D-PYDQSFESRDLLIDEWKSLTYDEVISF 348
            : |:..:.|:.|:..|..|||.::|.:.|
  Fly   339 EVPFRINMENDDISRDALKSLIFEETLKF 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mapk14NP_001161980.1 STKc_p38alpha 6..350 CDD:143382 166/350 (47%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 163/335 (49%)
S_TKc 38..326 CDD:214567 142/289 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0660
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.