DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCG and DAP2

DIOPT Version :10

Sequence 1:NP_002045.1 Gene:GCG / 2641 HGNCID:4191 Length:180 Species:Homo sapiens
Sequence 2:NP_011893.1 Gene:DAP2 / 856423 SGDID:S000001070 Length:818 Species:Saccharomyces cerevisiae


Alignment Length:33 Identity:8/33 - (24%)
Similarity:17/33 - (51%) Gaps:2/33 - (6%)


- Green bases have known domain annotations that are detailed below.


Human    45 DQMNEDKRHSQGTFTSDYSKYL--DSRRAQDFV 75
            :::.||.:.:..:.|.||..:|  |.....:|:
Yeast   242 EEVFEDDKAAWWSPTGDYLAFLKIDESEVGEFI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCGNP_002045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..59 2/13 (15%)
Hormone_2 53..80 CDD:459681 6/25 (24%)
Hormone_2 98..125 CDD:459681
Hormone_2 146..173 CDD:459681
DAP2NP_011893.1 DPPIV_N 148..508 CDD:395744 8/33 (24%)
Peptidase_S9 608..815 CDD:459761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.