Sequence 1: | NP_002045.1 | Gene: | GCG / 2641 | HGNCID: | 4191 | Length: | 180 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001006913.1 | Gene: | gcg / 448760 | XenbaseID: | XB-GENE-1000156 | Length: | 266 | Species: | Xenopus tropicalis |
Alignment Length: | 261 | Identity: | 99/261 - (37%) |
---|---|---|---|
Similarity: | 143/261 - (54%) | Gaps: | 83/261 - (31%) |
- Green bases have known domain annotations that are detailed below.
Human 1 MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKY 65
Human 66 LDSRRAQDFVQWLMNTKRN---------------------------------------------- 84
Human 85 ----RNNIAKRHDE--------------------------------FERHAEGTFTSDVSSYLEG 113
Human 114 QAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITD 178
Human 179 R 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GCG | NP_002045.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 26..59 | 15/32 (47%) | |
Hormone_2 | 53..80 | CDD:395073 | 25/26 (96%) | ||
Hormone_2 | 98..124 | CDD:395073 | 17/25 (68%) | ||
Hormone_2 | 146..173 | CDD:395073 | 13/26 (50%) | ||
gcg | NP_001006913.1 | Hormone_2 | 53..80 | CDD:365889 | 25/26 (96%) |
Hormone_2 | 97..124 | CDD:365889 | 0/26 (0%) | ||
Hormone_2 | 142..169 | CDD:365889 | 2/26 (8%) | ||
Hormone_2 | 180..207 | CDD:365889 | 18/26 (69%) | ||
Hormone_2 | 227..254 | CDD:365889 | 13/26 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 63 | 1.000 | Domainoid score | I37611 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 176 | 1.000 | Inparanoid score | I12334 |
NCBI | 1 | 1.000 | - | - | ||
OMA | 1 | 1.010 | - | - | QHG41657 | |
OrthoDB | 1 | 1.010 | - | - | D1349644at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0007968 | |
OrthoInspector | 1 | 1.000 | - | - | oto157469 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR11418 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6741 |
SonicParanoid | 1 | 1.000 | - | - | X9991 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
12 | 12.110 |