DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCG and gcg

DIOPT Version :9

Sequence 1:NP_002045.1 Gene:GCG / 2641 HGNCID:4191 Length:180 Species:Homo sapiens
Sequence 2:NP_001006913.1 Gene:gcg / 448760 XenbaseID:XB-GENE-1000156 Length:266 Species:Xenopus tropicalis


Alignment Length:261 Identity:99/261 - (37%)
Similarity:143/261 - (54%) Gaps:83/261 - (31%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKY 65
            |||.|::.|:.:|::..::|..:.:|:..|||..|::.:.:.|..|:.|.|||||||||||||||
 Frog     1 MKSTYYMIGILLMILHNTYQSPVPETDASSRSVKAARNEAVDDSQQLKEVKRHSQGTFTSDYSKY 65

Human    66 LDSRRAQDFVQWLMNTKRN---------------------------------------------- 84
            |||||||||:||||||||:                                              
 Frog    66 LDSRRAQDFIQWLMNTKRSGGLSRRNADYERHAEGTFTSDVTQHLDEKAAKEFIDWLINGGPSKE 130

Human    85 ----RNNIAKRHDE--------------------------------FERHAEGTFTSDVSSYLEG 113
                ||...:||.|                                :.||||||||:|:::|||.
 Frog   131 IISRRNADVERHAEGTYTNDVTEYLEEKAAKEFIEWLINGKPKKIRYSRHAEGTFTNDMTNYLEE 195

Human   114 QAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITD 178
            :|||||:.||:|||.:|:| .|...|||:.||||||||::::|.:||.:||::|::|:|.|::|:
 Frog   196 KAAKEFVGWLIKGRPKRNF-SEAHSVEEMDRRHADGSFTNDINKVLDIIAAQEFLDWVINTQVTE 259

Human   179 R 179
            |
 Frog   260 R 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCGNP_002045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..59 15/32 (47%)
Hormone_2 53..80 CDD:395073 25/26 (96%)
Hormone_2 98..124 CDD:395073 17/25 (68%)
Hormone_2 146..173 CDD:395073 13/26 (50%)
gcgNP_001006913.1 Hormone_2 53..80 CDD:365889 25/26 (96%)
Hormone_2 97..124 CDD:365889 0/26 (0%)
Hormone_2 142..169 CDD:365889 2/26 (8%)
Hormone_2 180..207 CDD:365889 18/26 (69%)
Hormone_2 227..254 CDD:365889 13/26 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I37611
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I12334
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG41657
OrthoDB 1 1.010 - - D1349644at2759
OrthoFinder 1 1.000 - - FOG0007968
OrthoInspector 1 1.000 - - oto157469
Panther 1 1.100 - - LDO PTHR11418
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6741
SonicParanoid 1 1.000 - - X9991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.