DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCG and ome

DIOPT Version :10

Sequence 1:NP_002045.1 Gene:GCG / 2641 HGNCID:4191 Length:180 Species:Homo sapiens
Sequence 2:NP_001097606.1 Gene:ome / 44297 FlyBaseID:FBgn0259175 Length:1040 Species:Drosophila melanogaster


Alignment Length:193 Identity:36/193 - (18%)
Similarity:69/193 - (35%) Gaps:59/193 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    26 TEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSK-----YLDSRRAQDFVQWLMNTKRNR 85
            |:||....|.|.::...|.:.:...:.::: .|...:|.     |.::....:|     :.|...
  Fly   292 TDEKDADDSDSNSNNAIDLEDVLSGQLYAK-RFNGSWSNGNSLIYKENTSIMEF-----DAKTGE 350

Human    86 NNI----AKRHDEFERHAEGTFTSDVSSY-------------LEGQAAKEFI------------- 120
            .:|    |:.:..:|:.|:|.|.....:|             |.....||||             
  Fly   351 RSILLEDAQHYVLYEKSADGEFLLLAKNYKKNFRYSFLAEYDLYNLNTKEFIQLTIQNEQHYLSM 415

Human   121 -AW------LVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKI 176
             .|      ||....|..:.:|.|:.:|:...      |||...||:.:.     :|:.:.::
  Fly   416 VQWSPVGNALVINYDRNLYYKESALAQEIALT------SDEQAGILNGIP-----DWVYEEEV 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCGNP_002045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..59 6/32 (19%)
Hormone_2 53..80 CDD:459681 4/31 (13%)
Hormone_2 98..125 CDD:459681 11/59 (19%)
Hormone_2 146..173 CDD:459681 6/26 (23%)
omeNP_001097606.1 DPPIV_N 367..739 CDD:395744 22/112 (20%)
Peptidase_S9 828..1033 CDD:459761
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.