DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GCG and Gcg

DIOPT Version :9

Sequence 1:NP_002045.1 Gene:GCG / 2641 HGNCID:4191 Length:180 Species:Homo sapiens
Sequence 2:XP_038960240.1 Gene:Gcg / 24952 RGDID:2668 Length:214 Species:Rattus norvegicus


Alignment Length:180 Identity:163/180 - (90%)
Similarity:171/180 - (95%) Gaps:0/180 - (0%)


- Green bases have known domain annotations that are detailed below.


Human     1 MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKY 65
            ||::|.||||||||||||||.:.|||||.:|||.|||.:||.||:|:||||||||||||||||||
  Rat    35 MKTVYIVAGLFVMLVQGSWQHAPQDTEENARSFPASQTEPLEDPNQINEDKRHSQGTFTSDYSKY 99

Human    66 LDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRR 130
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Rat   100 LDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRR 164

Human   131 DFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK 180
            ||||||||.||||||||||||||||||||||||.||||||||||||||:|
  Rat   165 DFPEEVAIAEELGRRHADGSFSDEMNTILDNLATRDFINWLIQTKITDKK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GCGNP_002045.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..59 24/32 (75%)
Hormone_2 53..80 CDD:395073 26/26 (100%)
Hormone_2 98..124 CDD:395073 25/25 (100%)
Hormone_2 146..173 CDD:395073 25/26 (96%)
GcgXP_038960240.1 Hormone_2 87..114 CDD:395073 26/26 (100%)
GLUCA 132..158 CDD:128384 25/25 (100%)
Hormone_2 180..207 CDD:395073 25/26 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C83686935
Domainoid 1 1.000 86 1.000 Domainoid score I45992
eggNOG 1 0.900 - - E1_2ABRC
HGNC 1 1.500 - -
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 340 1.000 Inparanoid score I14127
NCBI 1 1.000 - -
OMA 1 1.010 - - QHG41657
OrthoDB 1 1.010 - - D1349644at2759
OrthoFinder 1 1.000 - - FOG0007968
OrthoInspector 1 1.000 - - oto141353
orthoMCL 1 0.900 - - OOG6_117517
Panther 1 1.100 - - LDO PTHR11418
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9991
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1616.270

Return to query results.
Submit another query.